BLASTX nr result
ID: Acanthopanax23_contig00021714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021714 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 71 3e-13 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 70.9 bits (172), Expect = 3e-13 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -1 Query: 313 MNSQEYYQFSREVV--GMAWITLRIDYSRLFWLLFGVFSYENHEGK 182 M+S +Y +FSR+ V G+ WI LRIDYSRL WLLFGVFSYENHEGK Sbjct: 12 MDSHKYQEFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGK 57