BLASTX nr result
ID: Acanthopanax23_contig00021563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021563 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017230890.1| PREDICTED: serine/threonine-protein kinase C... 57 5e-06 ref|XP_017230889.1| PREDICTED: serine/threonine-protein kinase C... 57 6e-06 >ref|XP_017230890.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform X2 [Daucus carota subsp. sativus] Length = 373 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -2 Query: 171 MPNGTLQCHLHNPHN*SQQLK*GTRLRIAL-TRQSS*VPP*KQTPSVTHRDFKC 13 MPNGTLQ HLH P+N +Q L GTRLRIAL ++ TPSV HRDFKC Sbjct: 150 MPNGTLQQHLHTPNNRAQPLNWGTRLRIALDCARALEFLHEHTTPSVIHRDFKC 203 >ref|XP_017230889.1| PREDICTED: serine/threonine-protein kinase CDL1-like isoform X1 [Daucus carota subsp. sativus] gb|KZN10661.1| hypothetical protein DCAR_003317 [Daucus carota subsp. sativus] Length = 425 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -2 Query: 171 MPNGTLQCHLHNPHN*SQQLK*GTRLRIAL-TRQSS*VPP*KQTPSVTHRDFKC 13 MPNGTLQ HLH P+N +Q L GTRLRIAL ++ TPSV HRDFKC Sbjct: 202 MPNGTLQQHLHTPNNRAQPLNWGTRLRIALDCARALEFLHEHTTPSVIHRDFKC 255