BLASTX nr result
ID: Acanthopanax23_contig00021554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021554 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017239019.1| PREDICTED: serine/arginine repetitive matrix... 68 1e-10 >ref|XP_017239019.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Daucus carota subsp. sativus] gb|KZN00983.1| hypothetical protein DCAR_009737 [Daucus carota subsp. sativus] Length = 278 Score = 68.2 bits (165), Expect = 1e-10 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = +1 Query: 127 KKIEPMDLSKPTXXXXXXXXXXXXXXXMCSFSGNFSTTTTLNEKNEGEVTQRVVPHS--- 297 KKIEP+ ++KPT CSFSG+FS TTT+NEK++GEVTQRV P S Sbjct: 76 KKIEPIGVTKPTEQEISLVSEISEASEFCSFSGSFS-TTTVNEKDDGEVTQRVGPRSPAK 134 Query: 298 TPRKRSYSGELHGTR 342 TPRK +YSGE+ R Sbjct: 135 TPRKCTYSGEVKRER 149