BLASTX nr result
ID: Acanthopanax23_contig00021422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021422 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022011258.1| tubulin gamma-1 chain [Helianthus annuus] 143 4e-38 gb|OTF94464.1| putative gamma-tubulin [Helianthus annuus] 143 4e-38 gb|KCW71531.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus g... 140 8e-38 ref|XP_023746442.1| tubulin gamma-1 chain [Lactuca sativa] >gi|1... 142 1e-37 ref|XP_022035745.1| tubulin gamma-1 chain-like [Helianthus annuu... 142 1e-37 gb|KVH89050.1| hypothetical protein Ccrd_008966 [Cynara carduncu... 142 1e-37 ref|XP_022561032.1| tubulin gamma-1 chain-like [Brassica napus] 131 5e-37 ref|XP_017236087.1| PREDICTED: tubulin gamma-1 chain [Daucus car... 140 5e-37 ref|XP_010055050.1| PREDICTED: tubulin gamma-1 chain [Eucalyptus... 140 6e-37 ref|XP_021653324.1| tubulin gamma-1 chain [Hevea brasiliensis] >... 139 2e-36 gb|PON97520.1| Gamma tubulin [Trema orientalis] 138 3e-36 gb|PON71274.1| Gamma tubulin [Parasponia andersonii] 138 3e-36 ref|XP_021612132.1| tubulin gamma-1 chain [Manihot esculenta] >g... 138 5e-36 ref|XP_012083257.1| tubulin gamma-1 chain [Jatropha curcas] >gi|... 138 5e-36 gb|PKI76620.1| hypothetical protein CRG98_002929 [Punica granatum] 137 5e-36 gb|OWM68683.1| hypothetical protein CDL15_Pgr023648 [Punica gran... 137 7e-36 gb|AFK35682.1| unknown [Lotus japonicus] 127 1e-35 ref|XP_018827898.1| PREDICTED: tubulin gamma-1 chain [Juglans re... 137 1e-35 ref|XP_010661882.1| PREDICTED: tubulin gamma-1 chain [Vitis vini... 137 1e-35 ref|XP_006444887.1| tubulin gamma-1 chain [Citrus clementina] >g... 137 1e-35 >ref|XP_022011258.1| tubulin gamma-1 chain [Helianthus annuus] Length = 474 Score = 143 bits (361), Expect = 4e-38 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYR FP+F DNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDKYRDFPMFSDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 465 TGTVDPKLAM 474 >gb|OTF94464.1| putative gamma-tubulin [Helianthus annuus] Length = 475 Score = 143 bits (361), Expect = 4e-38 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYR FP+F DNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDKYRDFPMFSDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 465 TGTVDPKLAM 474 >gb|KCW71531.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus grandis] Length = 356 Score = 140 bits (353), Expect = 8e-38 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 287 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 346 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 347 TGTVDPKLAV 356 >ref|XP_023746442.1| tubulin gamma-1 chain [Lactuca sativa] gb|PLY64236.1| hypothetical protein LSAT_7X1921 [Lactuca sativa] Length = 474 Score = 142 bits (358), Expect = 1e-37 Identities = 64/70 (91%), Positives = 69/70 (98%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYR FPLFDDNDLSEFDE+RD+IESLVDEYKACESPDYIKWGMEDPDH+LTGEG+A Sbjct: 405 AFLDKYRGFPLFDDNDLSEFDESRDVIESLVDEYKACESPDYIKWGMEDPDHLLTGEGSA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 465 TGTVDPKLAM 474 >ref|XP_022035745.1| tubulin gamma-1 chain-like [Helianthus annuus] gb|OTG29325.1| putative tubulin gamma-2 chain [Helianthus annuus] Length = 474 Score = 142 bits (358), Expect = 1e-37 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYR FP+F DNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDKYRDFPMFSDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGT+DPKLA+ Sbjct: 465 TGTLDPKLAM 474 >gb|KVH89050.1| hypothetical protein Ccrd_008966 [Cynara cardunculus var. scolymus] Length = 485 Score = 142 bits (358), Expect = 1e-37 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYR +PLFDDNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEG+A Sbjct: 416 AFLDKYRGYPLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGSA 475 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 476 TGTVDPKLAM 485 >ref|XP_022561032.1| tubulin gamma-1 chain-like [Brassica napus] Length = 117 Score = 131 bits (330), Expect = 5e-37 Identities = 60/69 (86%), Positives = 64/69 (92%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDP+ +LTGEGNA Sbjct: 48 AFLDNYRKFPMFADNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPEQLLTGEGNA 107 Query: 221 TGTVDPKLA 195 +G VDPKLA Sbjct: 108 SGVVDPKLA 116 >ref|XP_017236087.1| PREDICTED: tubulin gamma-1 chain [Daucus carota subsp. sativus] gb|KZN06128.1| hypothetical protein DCAR_006965 [Daucus carota subsp. sativus] Length = 477 Score = 140 bits (354), Expect = 5e-37 Identities = 64/67 (95%), Positives = 67/67 (100%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLDKYRSFPLFDDNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDKYRSFPLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPK 201 TG+VDP+ Sbjct: 465 TGSVDPR 471 >ref|XP_010055050.1| PREDICTED: tubulin gamma-1 chain [Eucalyptus grandis] gb|KCW71530.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus grandis] Length = 474 Score = 140 bits (353), Expect = 6e-37 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 465 TGTVDPKLAV 474 >ref|XP_021653324.1| tubulin gamma-1 chain [Hevea brasiliensis] ref|XP_021653326.1| tubulin gamma-1 chain [Hevea brasiliensis] Length = 474 Score = 139 bits (349), Expect = 2e-36 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKL + Sbjct: 465 TGTVDPKLTV 474 >gb|PON97520.1| Gamma tubulin [Trema orientalis] Length = 467 Score = 138 bits (348), Expect = 3e-36 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA Sbjct: 398 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA 457 Query: 221 TGTVDPKLAI 192 +GTVDPKLA+ Sbjct: 458 SGTVDPKLAV 467 >gb|PON71274.1| Gamma tubulin [Parasponia andersonii] Length = 474 Score = 138 bits (348), Expect = 3e-36 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA 464 Query: 221 TGTVDPKLAI 192 +GTVDPKLA+ Sbjct: 465 SGTVDPKLAV 474 >ref|XP_021612132.1| tubulin gamma-1 chain [Manihot esculenta] gb|OAY62195.1| hypothetical protein MANES_01G249000 [Manihot esculenta] Length = 473 Score = 138 bits (347), Expect = 5e-36 Identities = 63/69 (91%), Positives = 66/69 (95%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLA 195 TGTVDPKL+ Sbjct: 465 TGTVDPKLS 473 >ref|XP_012083257.1| tubulin gamma-1 chain [Jatropha curcas] gb|KDP28521.1| hypothetical protein JCGZ_14292 [Jatropha curcas] Length = 474 Score = 138 bits (347), Expect = 5e-36 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDP LA+ Sbjct: 465 TGTVDPNLAV 474 >gb|PKI76620.1| hypothetical protein CRG98_002929 [Punica granatum] Length = 456 Score = 137 bits (346), Expect = 5e-36 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA Sbjct: 387 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA 446 Query: 221 TGTVDPKLAI 192 GTVDPKLA+ Sbjct: 447 MGTVDPKLAV 456 >gb|OWM68683.1| hypothetical protein CDL15_Pgr023648 [Punica granatum] Length = 483 Score = 137 bits (346), Expect = 7e-36 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA Sbjct: 414 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA 473 Query: 221 TGTVDPKLAI 192 GTVDPKLA+ Sbjct: 474 MGTVDPKLAV 483 >gb|AFK35682.1| unknown [Lotus japonicus] Length = 96 Score = 127 bits (319), Expect = 1e-35 Identities = 56/70 (80%), Positives = 65/70 (92%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDP+++L+GEGN Sbjct: 27 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPNNMLSGEGNV 86 Query: 221 TGTVDPKLAI 192 TG++DPKL + Sbjct: 87 TGSLDPKLVV 96 >ref|XP_018827898.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] ref|XP_018827899.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] ref|XP_018827900.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] Length = 474 Score = 137 bits (344), Expect = 1e-35 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPD +LTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDQVLTGEGNA 464 Query: 221 TGTVDPKLAI 192 TGTVDPKLA+ Sbjct: 465 TGTVDPKLAV 474 >ref|XP_010661882.1| PREDICTED: tubulin gamma-1 chain [Vitis vinifera] emb|CBI40476.3| unnamed protein product, partial [Vitis vinifera] Length = 474 Score = 137 bits (344), Expect = 1e-35 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 +G VDPKLA+ Sbjct: 465 SGAVDPKLAV 474 >ref|XP_006444887.1| tubulin gamma-1 chain [Citrus clementina] ref|XP_006491234.1| PREDICTED: tubulin gamma-1 chain [Citrus sinensis] ref|XP_024042658.1| tubulin gamma-1 chain [Citrus clementina] gb|ESR58127.1| hypothetical protein CICLE_v10019995mg [Citrus clementina] gb|KDO86402.1| hypothetical protein CISIN_1g046749mg [Citrus sinensis] dbj|GAY51380.1| hypothetical protein CUMW_133760 [Citrus unshiu] Length = 474 Score = 137 bits (344), Expect = 1e-35 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -2 Query: 401 AFLDKYRSFPLFDDNDLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 222 AFLD YR FP+F DNDLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA Sbjct: 405 AFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA 464 Query: 221 TGTVDPKLAI 192 TG+VDP LA+ Sbjct: 465 TGSVDPNLAV 474