BLASTX nr result
ID: Acanthopanax23_contig00021410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021410 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13433.1| unnamed protein product [Coffea canephora] 64 6e-09 gb|KZV32242.1| putative plant SNARE 11 [Dorcoceras hygrometricum] 62 2e-08 ref|XP_011031998.1| PREDICTED: novel plant SNARE 11-like [Populu... 60 1e-07 ref|XP_008448761.1| PREDICTED: novel plant SNARE 11 [Cucumis mel... 60 1e-07 ref|XP_004147245.1| PREDICTED: novel plant SNARE 11 [Cucumis sat... 60 1e-07 gb|PIM98150.1| hypothetical protein CDL12_29372 [Handroanthus im... 58 2e-07 ref|XP_006385386.1| hypothetical protein POPTR_0003s03300g [Popu... 58 2e-07 ref|XP_022892777.1| novel plant SNARE 11-like [Olea europaea var... 59 3e-07 gb|EYU17864.1| hypothetical protein MIMGU_mgv1a0146532mg, partia... 54 4e-07 ref|XP_018837578.1| PREDICTED: novel plant SNARE 11-like [Juglan... 55 6e-07 ref|XP_011070289.1| novel plant SNARE 11 [Sesamum indicum] >gi|7... 58 7e-07 ref|XP_022871034.1| novel plant SNARE 11-like [Olea europaea var... 58 7e-07 ref|XP_021689682.1| LOW QUALITY PROTEIN: novel plant SNARE 11 [H... 58 8e-07 gb|PNT54605.1| hypothetical protein POPTR_001G149200v3 [Populus ... 58 1e-06 ref|XP_023553230.1| novel plant SNARE 11-like [Cucurbita pepo su... 57 2e-06 ref|XP_022923361.1| novel plant SNARE 11-like [Cucurbita moschat... 57 2e-06 ref|XP_011018669.1| PREDICTED: novel plant SNARE 11-like isoform... 57 2e-06 ref|XP_006385586.1| SNARE 11 family protein [Populus trichocarpa... 57 2e-06 gb|OWM86370.1| hypothetical protein CDL15_Pgr021456 [Punica gran... 57 3e-06 ref|XP_008799404.1| PREDICTED: novel plant SNARE 11-like [Phoeni... 57 3e-06 >emb|CDP13433.1| unnamed protein product [Coffea canephora] Length = 261 Score = 63.9 bits (154), Expect = 6e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 K+VNPHNKDIRDIPGLAPP PSRKLLWN N Sbjct: 232 KIVNPHNKDIRDIPGLAPPAPSRKLLWNPN 261 >gb|KZV32242.1| putative plant SNARE 11 [Dorcoceras hygrometricum] Length = 261 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNS 123 K+VNPHNKDIRDIPGLAPP P+RKLLWNS Sbjct: 232 KIVNPHNKDIRDIPGLAPPAPTRKLLWNS 260 >ref|XP_011031998.1| PREDICTED: novel plant SNARE 11-like [Populus euphratica] Length = 266 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN*E 132 KLVNP NKDIRDIPGLAPP PSR+LLWN N E Sbjct: 233 KLVNPSNKDIRDIPGLAPPAPSRRLLWNPNQE 264 >ref|XP_008448761.1| PREDICTED: novel plant SNARE 11 [Cucumis melo] ref|XP_008448762.1| PREDICTED: novel plant SNARE 11 [Cucumis melo] Length = 261 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNS 123 KLVNP+NKDIRDIPGLAPPV SRKLLWNS Sbjct: 232 KLVNPNNKDIRDIPGLAPPVQSRKLLWNS 260 >ref|XP_004147245.1| PREDICTED: novel plant SNARE 11 [Cucumis sativus] gb|KGN55810.1| hypothetical protein Csa_3G017040 [Cucumis sativus] Length = 261 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNS 123 KLVNP+NKDIRDIPGLAPPV SRKLLWNS Sbjct: 232 KLVNPNNKDIRDIPGLAPPVQSRKLLWNS 260 >gb|PIM98150.1| hypothetical protein CDL12_29372 [Handroanthus impetiginosus] Length = 130 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 K+VNP+NKDIRDIPGLAPP P+RKLLW S+ Sbjct: 101 KIVNPNNKDIRDIPGLAPPAPTRKLLWKSD 130 >ref|XP_006385386.1| hypothetical protein POPTR_0003s03300g [Populus trichocarpa] Length = 147 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNP+NKDIRDIPGLAPP SR+LLWN N Sbjct: 118 KLVNPNNKDIRDIPGLAPPAQSRRLLWNPN 147 >ref|XP_022892777.1| novel plant SNARE 11-like [Olea europaea var. sylvestris] Length = 261 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWN 120 K+VNP+NKDIRDIPGLAPP PSRKLLWN Sbjct: 232 KIVNPNNKDIRDIPGLAPPAPSRKLLWN 259 >gb|EYU17864.1| hypothetical protein MIMGU_mgv1a0146532mg, partial [Erythranthe guttata] Length = 29 Score = 54.3 bits (129), Expect = 4e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 40 LVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 +VNP NKDIRDIPGLAPP P+RKLLW S+ Sbjct: 1 IVNPQNKDIRDIPGLAPPAPARKLLWISD 29 >ref|XP_018837578.1| PREDICTED: novel plant SNARE 11-like [Juglans regia] Length = 82 Score = 55.1 bits (131), Expect = 6e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNP+NKDIRDIPGLAPP +R+LLWN++ Sbjct: 53 KLVNPNNKDIRDIPGLAPPAMTRRLLWNAS 82 >ref|XP_011070289.1| novel plant SNARE 11 [Sesamum indicum] ref|XP_011070290.1| novel plant SNARE 11 [Sesamum indicum] Length = 254 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 K+VNP+NKDIRDIPGLAPP P+RKLLW+S+ Sbjct: 225 KIVNPNNKDIRDIPGLAPPAPARKLLWSSD 254 >ref|XP_022871034.1| novel plant SNARE 11-like [Olea europaea var. sylvestris] Length = 261 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNP+NKDIRD+PGLAPP PSRKLLW N Sbjct: 232 KLVNPNNKDIRDVPGLAPPAPSRKLLWIPN 261 >ref|XP_021689682.1| LOW QUALITY PROTEIN: novel plant SNARE 11 [Hevea brasiliensis] Length = 277 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN*E 132 KLVNP+NKDIRDIPGLAPP SR+LLWN N E Sbjct: 233 KLVNPNNKDIRDIPGLAPPAQSRRLLWNPNXE 264 >gb|PNT54605.1| hypothetical protein POPTR_001G149200v3 [Populus trichocarpa] Length = 262 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNP+NKDIRDIPGLAPP SR+LLWN N Sbjct: 233 KLVNPNNKDIRDIPGLAPPAQSRRLLWNPN 262 >ref|XP_023553230.1| novel plant SNARE 11-like [Cucurbita pepo subsp. pepo] Length = 261 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNS 123 KLVNP+NKDI+DIPGLAPP SRKLLWNS Sbjct: 232 KLVNPNNKDIQDIPGLAPPAQSRKLLWNS 260 >ref|XP_022923361.1| novel plant SNARE 11-like [Cucurbita moschata] ref|XP_022965148.1| novel plant SNARE 11-like [Cucurbita maxima] Length = 261 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNS 123 KLVNP+NKDI+DIPGLAPP SRKLLWNS Sbjct: 232 KLVNPNNKDIQDIPGLAPPAQSRKLLWNS 260 >ref|XP_011018669.1| PREDICTED: novel plant SNARE 11-like isoform X1 [Populus euphratica] Length = 262 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNP NKDIRDIPGLAPP SR+LLWN N Sbjct: 233 KLVNPKNKDIRDIPGLAPPAQSRRLLWNPN 262 >ref|XP_006385586.1| SNARE 11 family protein [Populus trichocarpa] gb|PNT44404.1| hypothetical protein POPTR_003G085200v3 [Populus trichocarpa] Length = 266 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN*E 132 KLVNP NKDIRDIPGLAPP PSR+LLW N E Sbjct: 233 KLVNPSNKDIRDIPGLAPPAPSRRLLWIPNQE 264 >gb|OWM86370.1| hypothetical protein CDL15_Pgr021456 [Punica granatum] gb|PKI53526.1| hypothetical protein CRG98_026071 [Punica granatum] Length = 261 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLW 117 KLVNP+NKDIRDIPGLAPP P+RKLLW Sbjct: 232 KLVNPNNKDIRDIPGLAPPAPTRKLLW 258 >ref|XP_008799404.1| PREDICTED: novel plant SNARE 11-like [Phoenix dactylifera] Length = 263 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 37 KLVNPHNKDIRDIPGLAPPVPSRKLLWNSN 126 KLVNPHNKDIRDIPGLAPPV SRKLLW+ N Sbjct: 233 KLVNPHNKDIRDIPGLAPPV-SRKLLWDLN 261