BLASTX nr result
ID: Acanthopanax23_contig00021379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021379 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024166977.1| MADS-box transcription factor ANR1-like isof... 54 4e-06 >ref|XP_024166977.1| MADS-box transcription factor ANR1-like isoform X6 [Rosa chinensis] Length = 103 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 188 SMKSVIGRYHKLKEEHHQLLNPTSEVKVLFLN 283 SMKSVI RY KLKEEHHQLLNP SEVKV+ ++ Sbjct: 61 SMKSVIDRYKKLKEEHHQLLNPASEVKVVHIH 92