BLASTX nr result
ID: Acanthopanax23_contig00021209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021209 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16176.3| unnamed protein product, partial [Vitis vinifera] 63 2e-08 ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat... 63 2e-08 gb|POE81471.1| putative pentatricopeptide repeat-containing prot... 58 1e-07 gb|POE81470.1| putative pentatricopeptide repeat-containing prot... 58 9e-07 ref|XP_023876268.1| putative pentatricopeptide repeat-containing... 58 9e-07 ref|XP_010103287.2| putative pentatricopeptide repeat-containing... 56 4e-06 ref|XP_010106220.1| putative pentatricopeptide repeat-containing... 56 4e-06 gb|EXC46504.1| hypothetical protein L484_000619 [Morus notabilis] 56 4e-06 >emb|CBI16176.3| unnamed protein product, partial [Vitis vinifera] Length = 819 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPT 117 L++AFELRDDM RRG+KPNRA Y SLIHGTC MSSV T Sbjct: 763 LTKAFELRDDMMRRGVKPNRATYNSLIHGTCLMSSVSST 801 >ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vitis vinifera] Length = 900 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPT 117 L++AFELRDDM RRG+KPNRA Y SLIHGTC MSSV T Sbjct: 860 LTKAFELRDDMMRRGVKPNRATYNSLIHGTCLMSSVSST 898 >gb|POE81471.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 143 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPT 117 L++AFELRDDM RRG+ PNR Y +LIHGTC SSVL T Sbjct: 105 LTKAFELRDDMIRRGVMPNRVTYNTLIHGTCLKSSVLST 143 >gb|POE81470.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 908 Score = 58.2 bits (139), Expect = 9e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPT 117 L++AFELRDDM RRG+ PNR Y +LIHGTC SSVL T Sbjct: 870 LTKAFELRDDMIRRGVMPNRVTYNTLIHGTCLKSSVLST 908 >ref|XP_023876268.1| putative pentatricopeptide repeat-containing protein At5g59900 [Quercus suber] ref|XP_023876269.1| putative pentatricopeptide repeat-containing protein At5g59900 [Quercus suber] Length = 922 Score = 58.2 bits (139), Expect = 9e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPT 117 L++AFELRDDM RRG+ PNR Y +LIHGTC SSVL T Sbjct: 884 LTKAFELRDDMIRRGVMPNRVTYNTLIHGTCLKSSVLST 922 >ref|XP_010103287.2| putative pentatricopeptide repeat-containing protein At5g59900 [Morus notabilis] Length = 910 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPTGG 123 L++AFELRDDM RRGL PN+ Y SL+ GTC S+V P GG Sbjct: 870 LNKAFELRDDMMRRGLMPNQFTYSSLMQGTCLASTVQPAGG 910 >ref|XP_010106220.1| putative pentatricopeptide repeat-containing protein At5g59900 [Morus notabilis] gb|EXC51944.1| hypothetical protein L484_000629 [Morus notabilis] Length = 910 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPTGG 123 L++AFELRDDM RRGL PN+ Y SL+ GTC S+V P GG Sbjct: 870 LTKAFELRDDMMRRGLMPNQFTYSSLMQGTCLASTVQPAGG 910 >gb|EXC46504.1| hypothetical protein L484_000619 [Morus notabilis] Length = 955 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 1 LSRAFELRDDMTRRGLKPNRAIYYSLIHGTCSMSSVLPTGG 123 L++AFELRDDM RRGL PN+ Y SL+ GTC S+V P GG Sbjct: 915 LNKAFELRDDMMRRGLMPNQFTYSSLMQGTCLASTVQPAGG 955