BLASTX nr result
ID: Acanthopanax23_contig00021154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021154 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP01443.1| hypothetical protein COLO4_11874 [Corchorus olito... 97 2e-20 gb|OMO54430.1| hypothetical protein CCACVL1_27806 [Corchorus cap... 97 2e-20 ref|XP_021280423.1| pentatricopeptide repeat-containing protein ... 96 5e-20 ref|XP_007050539.2| PREDICTED: pentatricopeptide repeat-containi... 96 5e-20 gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protei... 96 5e-20 ref|XP_022884484.1| pentatricopeptide repeat-containing protein ... 94 2e-19 gb|PNX89791.1| PPR containing plant protein [Trifolium pratense] 91 2e-19 ref|XP_022150210.1| pentatricopeptide repeat-containing protein ... 94 3e-19 ref|XP_018833062.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-19 ref|XP_011084681.1| pentatricopeptide repeat-containing protein ... 93 8e-19 gb|PPE00719.1| hypothetical protein GOBAR_DD02221 [Gossypium bar... 93 8e-19 ref|XP_017624011.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-19 ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-19 gb|PPR89085.1| hypothetical protein GOBAR_AA31601 [Gossypium bar... 92 2e-18 ref|XP_022758264.1| pentatricopeptide repeat-containing protein ... 92 2e-18 dbj|GAV82890.1| PPR domain-containing protein/PPR_2 domain-conta... 92 2e-18 gb|PKI55833.1| hypothetical protein CRG98_023775 [Punica granatum] 91 3e-18 gb|PIN21623.1| hypothetical protein CDL12_05659 [Handroanthus im... 91 3e-18 gb|OWM72069.1| hypothetical protein CDL15_Pgr017952 [Punica gran... 91 3e-18 ref|XP_013456736.1| PPR containing plant protein [Medicago trunc... 91 3e-18 >gb|OMP01443.1| hypothetical protein COLO4_11874 [Corchorus olitorius] Length = 708 Score = 97.4 bits (241), Expect = 2e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY Sbjct: 662 IDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 708 >gb|OMO54430.1| hypothetical protein CCACVL1_27806 [Corchorus capsularis] Length = 708 Score = 97.4 bits (241), Expect = 2e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY Sbjct: 662 IDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 708 >ref|XP_021280423.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Herrania umbratica] Length = 780 Score = 96.3 bits (238), Expect = 5e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAALTFKKWVGLY Sbjct: 734 IDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFKKWVGLY 780 >ref|XP_007050539.2| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Theobroma cacao] Length = 780 Score = 96.3 bits (238), Expect = 5e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAALTFKKWVGLY Sbjct: 734 IDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFKKWVGLY 780 >gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 96.3 bits (238), Expect = 5e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAALTFKKWVGLY Sbjct: 734 IDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFKKWVGLY 780 >ref|XP_022884484.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Olea europaea var. sylvestris] Length = 794 Score = 94.4 bits (233), Expect = 2e-19 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR+L+LKYHKTLYKGKAPKFQTESQLKKRE+ALTFKKWVGL Sbjct: 749 IDKYKYRMLFLKYHKTLYKGKAPKFQTESQLKKRESALTFKKWVGL 794 >gb|PNX89791.1| PPR containing plant protein [Trifolium pratense] Length = 252 Score = 91.3 bits (225), Expect = 2e-19 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR+L+LKYHKTLYKGKAPKFQTESQL KREAALTFK+W+G+ Sbjct: 206 IDKYKYRMLFLKYHKTLYKGKAPKFQTESQLNKREAALTFKRWIGM 251 >ref|XP_022150210.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Momordica charantia] ref|XP_022150211.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Momordica charantia] Length = 846 Score = 94.0 bits (232), Expect = 3e-19 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGLY 142 IDKYKYR L+LKYHKTLYKGKAPKFQTE+QL+KRE+ALTFKKWVGLY Sbjct: 800 IDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLRKRESALTFKKWVGLY 846 >ref|XP_018833062.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Juglans regia] Length = 785 Score = 93.2 bits (230), Expect = 6e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 +DKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAALTFKKWVGL Sbjct: 739 VDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALTFKKWVGL 784 >ref|XP_011084681.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] ref|XP_011084682.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 92.8 bits (229), Expect = 8e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR L+LKYHKTLYKGKAPKFQTESQLKKREAAL FKKWVGL Sbjct: 725 IDKYKYRALFLKYHKTLYKGKAPKFQTESQLKKREAALAFKKWVGL 770 >gb|PPE00719.1| hypothetical protein GOBAR_DD02221 [Gossypium barbadense] Length = 778 Score = 92.8 bits (229), Expect = 8e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR LYLKYHKTLYKGK PKFQTESQLKKREAAL+FKKW+GL Sbjct: 732 IDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALSFKKWIGL 777 >ref|XP_017624011.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium arboreum] Length = 778 Score = 92.8 bits (229), Expect = 8e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR LYLKYHKTLYKGK PKFQTESQLKKREAAL+FKKW+GL Sbjct: 732 IDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALSFKKWIGL 777 >ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium raimondii] gb|KJB22591.1| hypothetical protein B456_004G055800 [Gossypium raimondii] Length = 778 Score = 92.8 bits (229), Expect = 8e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR LYLKYHKTLYKGK PKFQTESQLKKREAAL+FKKW+GL Sbjct: 732 IDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALSFKKWIGL 777 >gb|PPR89085.1| hypothetical protein GOBAR_AA31601 [Gossypium barbadense] Length = 766 Score = 92.0 bits (227), Expect = 2e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR LYLKYHKTLYKGK PKFQTESQLKKREAAL+FKKW+G+ Sbjct: 720 IDKYKYRTLYLKYHKTLYKGKTPKFQTESQLKKREAALSFKKWIGI 765 >ref|XP_022758264.1| pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Durio zibethinus] Length = 790 Score = 92.0 bits (227), Expect = 2e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR L+LKYHKTLYKGKAPKFQTESQLKKREAAL FKKWVGL Sbjct: 744 IDKYKYRTLFLKYHKTLYKGKAPKFQTESQLKKREAALGFKKWVGL 789 >dbj|GAV82890.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 743 Score = 91.7 bits (226), Expect = 2e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 +DKYKYR LYLKYHKT+YKGKAPKFQTE+QLKKREAAL FKKW+GL Sbjct: 697 VDKYKYRTLYLKYHKTMYKGKAPKFQTEAQLKKREAALAFKKWIGL 742 >gb|PKI55833.1| hypothetical protein CRG98_023775 [Punica granatum] Length = 736 Score = 91.3 bits (225), Expect = 3e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 +DKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAAL FKKWVGL Sbjct: 690 VDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALAFKKWVGL 735 >gb|PIN21623.1| hypothetical protein CDL12_05659 [Handroanthus impetiginosus] Length = 772 Score = 91.3 bits (225), Expect = 3e-18 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR L+LKYHKTLYKGKAPKFQTESQLKKRE AL FKKWVGL Sbjct: 727 IDKYKYRALFLKYHKTLYKGKAPKFQTESQLKKRETALAFKKWVGL 772 >gb|OWM72069.1| hypothetical protein CDL15_Pgr017952 [Punica granatum] Length = 780 Score = 91.3 bits (225), Expect = 3e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 +DKYKYR L+LKYHKTLYKGKAPKFQTE+QLKKREAAL FKKWVGL Sbjct: 734 VDKYKYRTLFLKYHKTLYKGKAPKFQTEAQLKKREAALAFKKWVGL 779 >ref|XP_013456736.1| PPR containing plant protein [Medicago truncatula] gb|KEH30767.1| PPR containing plant protein [Medicago truncatula] Length = 786 Score = 91.3 bits (225), Expect = 3e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +2 Query: 2 IDKYKYRILYLKYHKTLYKGKAPKFQTESQLKKREAALTFKKWVGL 139 IDKYKYR+L+LKYHKTLYKGKAPKFQTESQL KREAALTFK+W+G+ Sbjct: 740 IDKYKYRMLFLKYHKTLYKGKAPKFQTESQLNKREAALTFKRWIGM 785