BLASTX nr result
ID: Acanthopanax23_contig00021005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00021005 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017230329.1| PREDICTED: uncharacterized protein LOC108205... 58 1e-06 ref|XP_017230327.1| PREDICTED: uncharacterized protein LOC108205... 58 1e-06 >ref|XP_017230329.1| PREDICTED: uncharacterized protein LOC108205065 isoform X2 [Daucus carota subsp. sativus] gb|KZN10226.1| hypothetical protein DCAR_002882 [Daucus carota subsp. sativus] Length = 463 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 500 QNSMENYPSSRSHDIYGGFQRQRSEEFRKAYNRY 399 QNS+E +P SRSHD YG +QRQR EEF KAYNRY Sbjct: 430 QNSVETFPPSRSHDAYGDYQRQRHEEFGKAYNRY 463 >ref|XP_017230327.1| PREDICTED: uncharacterized protein LOC108205065 isoform X1 [Daucus carota subsp. sativus] ref|XP_017230328.1| PREDICTED: uncharacterized protein LOC108205065 isoform X1 [Daucus carota subsp. sativus] Length = 465 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 500 QNSMENYPSSRSHDIYGGFQRQRSEEFRKAYNRY 399 QNS+E +P SRSHD YG +QRQR EEF KAYNRY Sbjct: 432 QNSVETFPPSRSHDAYGDYQRQRHEEFGKAYNRY 465