BLASTX nr result
ID: Acanthopanax23_contig00020593
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00020593 (870 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017249787.1| PREDICTED: protein trichome birefringence-li... 123 2e-28 emb|CDP03616.1| unnamed protein product [Coffea canephora] 121 1e-27 emb|CBI32367.3| unnamed protein product, partial [Vitis vinifera] 119 5e-27 gb|AQM54271.1| hypothetical protein 816152, partial [Populus pru... 110 7e-27 gb|AGE32507.1| hypothetical protein 816152, partial [Populus pru... 110 7e-27 gb|AGE32506.1| hypothetical protein 816152, partial [Populus pru... 110 7e-27 ref|XP_002272356.2| PREDICTED: protein trichome birefringence-li... 119 8e-27 gb|PIN25875.1| hypothetical protein CDL12_01392 [Handroanthus im... 113 1e-26 dbj|GAY40711.1| hypothetical protein CUMW_054100 [Citrus unshiu] 117 3e-26 gb|KDO68769.1| hypothetical protein CISIN_1g011120mg [Citrus sin... 117 4e-26 gb|KDO74765.1| hypothetical protein CISIN_1g0483592mg, partial [... 110 4e-26 gb|AQM54265.1| hypothetical protein 816152, partial [Populus pru... 108 4e-26 ref|XP_011071665.1| protein trichome birefringence-like 10 [Sesa... 116 6e-26 ref|XP_012832475.1| PREDICTED: protein trichome birefringence-li... 116 8e-26 ref|XP_022856199.1| protein trichome birefringence-like 10 [Olea... 115 9e-26 emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] 115 1e-25 ref|XP_023923830.1| protein trichome birefringence-like 10 [Quer... 115 1e-25 ref|XP_008222981.1| PREDICTED: protein trichome birefringence-li... 115 1e-25 ref|XP_008222980.1| PREDICTED: protein trichome birefringence-li... 115 1e-25 ref|XP_006444099.1| protein trichome birefringence-like 10 isofo... 115 2e-25 >ref|XP_017249787.1| PREDICTED: protein trichome birefringence-like 10 [Daucus carota subsp. sativus] gb|KZN10085.1| hypothetical protein DCAR_002741 [Daucus carota subsp. sativus] Length = 458 Score = 123 bits (308), Expect = 2e-28 Identities = 54/69 (78%), Positives = 61/69 (88%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+SQRKDGH+S+YYLGPETGPA LHRQDCSHWCLPG+PD+WNELLYAVFLK+ELA T N Sbjct: 387 MSSQRKDGHASIYYLGPETGPAALHRQDCSHWCLPGIPDTWNELLYAVFLKKELAQTGNK 446 Query: 690 TEPFHAPQV 664 TE +P V Sbjct: 447 TEHTLSPTV 455 >emb|CDP03616.1| unnamed protein product [Coffea canephora] Length = 472 Score = 121 bits (303), Expect = 1e-27 Identities = 52/67 (77%), Positives = 57/67 (85%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTSQRKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPDSWNELLYA L++EL +NS Sbjct: 404 MTSQRKDGHSSLYYLGPKAGPAPLHRQDCSHWCLPGVPDSWNELLYAALLRKELTDAQNS 463 Query: 690 TEPFHAP 670 + H P Sbjct: 464 AQHLHPP 470 >emb|CBI32367.3| unnamed protein product, partial [Vitis vinifera] Length = 419 Score = 119 bits (297), Expect = 5e-27 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS RKDGHSS+YYLGP GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLKRE TRNS Sbjct: 346 MTSLRKDGHSSVYYLGPGLGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNS 405 Query: 690 T 688 T Sbjct: 406 T 406 >gb|AQM54271.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54273.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54278.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 110 bits (274), Expect = 7e-27 Identities = 48/69 (69%), Positives = 56/69 (81%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+++RKDGH+SLYYLGP GPA LHRQDCSHWCLPGVPDSWNELLY + LK+EL ++ Sbjct: 23 MSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLJLKQELVHVQDL 82 Query: 690 TEPFHAPQV 664 TE AP V Sbjct: 83 TESSQAPSV 91 >gb|AGE32507.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32509.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32511.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32512.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32513.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32514.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32515.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32516.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32517.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32518.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32519.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32520.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32521.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32522.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32523.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32524.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32525.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32526.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32527.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32528.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32529.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32530.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32531.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32532.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32533.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32610.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32611.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54254.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54262.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54263.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54264.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54266.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54268.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54269.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54270.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54272.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54274.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54275.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54276.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54277.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54279.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54280.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54281.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54282.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54283.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54284.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54285.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54286.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 110 bits (274), Expect = 7e-27 Identities = 48/69 (69%), Positives = 56/69 (81%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+++RKDGH+SLYYLGP GPA LHRQDCSHWCLPGVPDSWNELLY + LK+EL ++ Sbjct: 23 MSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLILKQELVHVQDL 82 Query: 690 TEPFHAPQV 664 TE AP V Sbjct: 83 TESSQAPSV 91 >gb|AGE32506.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32508.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32510.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32612.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32613.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32614.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32615.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32616.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32617.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32618.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32619.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32620.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32621.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32622.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32623.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32624.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32625.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32626.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32627.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32628.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32629.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32630.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32631.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32632.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32633.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32634.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32635.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32636.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32637.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32638.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32639.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32640.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32641.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32642.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32643.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32644.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32645.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32646.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32647.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32648.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32649.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32650.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32651.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32652.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32653.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32654.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32655.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54219.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54220.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54221.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54222.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54223.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54224.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54225.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54226.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54227.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54228.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54229.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54230.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54231.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54232.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54233.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54234.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54235.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54236.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54237.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54238.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54239.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54240.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54241.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54242.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54243.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54244.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54245.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54246.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54247.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54248.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54249.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54250.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54251.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54252.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54253.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54255.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54256.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54257.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54258.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54259.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54260.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54261.1| hypothetical protein 816152, partial [Populus euphratica] Length = 93 Score = 110 bits (274), Expect = 7e-27 Identities = 48/69 (69%), Positives = 56/69 (81%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+++RKDGH+SLYYLGP GPA LHRQDCSHWCLPGVPDSWNELLY + LK+EL ++ Sbjct: 23 MSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLLLKQELVHVQDL 82 Query: 690 TEPFHAPQV 664 TE AP V Sbjct: 83 TESSQAPSV 91 >ref|XP_002272356.2| PREDICTED: protein trichome birefringence-like 10 [Vitis vinifera] Length = 463 Score = 119 bits (297), Expect = 8e-27 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS RKDGHSS+YYLGP GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLKRE TRNS Sbjct: 390 MTSLRKDGHSSVYYLGPGLGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNS 449 Query: 690 T 688 T Sbjct: 450 T 450 >gb|PIN25875.1| hypothetical protein CDL12_01392 [Handroanthus impetiginosus] Length = 203 Score = 113 bits (282), Expect = 1e-26 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELA 706 MTS+RKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLK+ ++ Sbjct: 145 MTSRRKDGHSSLYYLGPKAGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKQGIS 199 >dbj|GAY40711.1| hypothetical protein CUMW_054100 [Citrus unshiu] Length = 467 Score = 117 bits (293), Expect = 3e-26 Identities = 51/67 (76%), Positives = 59/67 (88%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS+RKDGHSS+Y+LGP+ GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLK+E + +NS Sbjct: 400 MTSRRKDGHSSVYFLGPKRGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKQETSHAQNS 459 Query: 690 TEPFHAP 670 E AP Sbjct: 460 AEHPQAP 466 >gb|KDO68769.1| hypothetical protein CISIN_1g011120mg [Citrus sinensis] Length = 493 Score = 117 bits (293), Expect = 4e-26 Identities = 51/67 (76%), Positives = 59/67 (88%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS+RKDGHSS+Y+LGP+ GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLK+E + +NS Sbjct: 426 MTSRRKDGHSSVYFLGPKRGPAPLHRQDCSHWCLPGVPDSWNELLYALFLKQETSHAQNS 485 Query: 690 TEPFHAP 670 E AP Sbjct: 486 AEHPQAP 492 >gb|KDO74765.1| hypothetical protein CISIN_1g0483592mg, partial [Citrus sinensis] Length = 174 Score = 110 bits (276), Expect = 4e-26 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MT+QRKDGHSSLYY+GP+ PAP+HRQDCSHWCLPGVPDSWNELLYA+FLKR+ N+ Sbjct: 108 MTAQRKDGHSSLYYMGPKASPAPIHRQDCSHWCLPGVPDSWNELLYALFLKRKTTHALNT 167 Query: 690 T 688 + Sbjct: 168 S 168 >gb|AQM54265.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54267.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 108 bits (269), Expect = 4e-26 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+++RKDGH+SLYYLGP GPA LHRQDCSHWCLPGVPDSWNELLY + K+EL ++ Sbjct: 23 MSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVPDSWNELLYTLIXKQELVHVQDL 82 Query: 690 TEPFHAPQV 664 TE AP V Sbjct: 83 TESSQAPSV 91 >ref|XP_011071665.1| protein trichome birefringence-like 10 [Sesamum indicum] Length = 440 Score = 116 bits (290), Expect = 6e-26 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 M+S+RKDGHSSLYYLGP+TGPAP+HRQDCSHWCLPGVPD+WNELLYA+FLK E T NS Sbjct: 374 MSSRRKDGHSSLYYLGPKTGPAPIHRQDCSHWCLPGVPDTWNELLYALFLKNEATRTSNS 433 Query: 690 T 688 + Sbjct: 434 S 434 >ref|XP_012832475.1| PREDICTED: protein trichome birefringence-like 11 [Erythranthe guttata] gb|EYU41525.1| hypothetical protein MIMGU_mgv1a021660mg [Erythranthe guttata] Length = 468 Score = 116 bits (290), Expect = 8e-26 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS+RKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPD+WNELLYA+ LKRE+ NS Sbjct: 402 MTSRRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPDAWNELLYALVLKREITGKSNS 461 Query: 690 TEPFHA 673 + FHA Sbjct: 462 SS-FHA 466 >ref|XP_022856199.1| protein trichome birefringence-like 10 [Olea europaea var. sylvestris] Length = 453 Score = 115 bits (289), Expect = 9e-26 Identities = 52/67 (77%), Positives = 56/67 (83%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTSQRKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPDSWNELL AVF KR+ +N Sbjct: 386 MTSQRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPDSWNELLLAVFHKRKFTRGQNL 445 Query: 690 TEPFHAP 670 T P +P Sbjct: 446 TIPSASP 452 >emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] Length = 463 Score = 115 bits (289), Expect = 1e-25 Identities = 52/61 (85%), Positives = 54/61 (88%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS RKDGHSS+YYLGP GPA LHRQDCSHWCLPGVPDSWNELLYA+FLKRE TRNS Sbjct: 390 MTSLRKDGHSSVYYLGPGLGPAXLHRQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNS 449 Query: 690 T 688 T Sbjct: 450 T 450 >ref|XP_023923830.1| protein trichome birefringence-like 10 [Quercus suber] gb|POE96388.1| protein trichome birefringence-like 10 [Quercus suber] Length = 449 Score = 115 bits (288), Expect = 1e-25 Identities = 48/62 (77%), Positives = 57/62 (91%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MT+QRKDGHSSLYYLGP+ GPAP+HRQDCSHWCLPGVPD+WNELLYA+FLKRE + N+ Sbjct: 387 MTAQRKDGHSSLYYLGPDVGPAPIHRQDCSHWCLPGVPDTWNELLYALFLKREATHSYNA 446 Query: 690 TE 685 ++ Sbjct: 447 SK 448 >ref|XP_008222981.1| PREDICTED: protein trichome birefringence-like 10 isoform X2 [Prunus mume] Length = 455 Score = 115 bits (288), Expect = 1e-25 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MT++RKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPD+WNELLYA+FLKRE+ NS Sbjct: 389 MTARRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPDTWNELLYALFLKREMTSKFNS 448 Query: 690 T 688 + Sbjct: 449 S 449 >ref|XP_008222980.1| PREDICTED: protein trichome birefringence-like 10 isoform X1 [Prunus mume] Length = 456 Score = 115 bits (288), Expect = 1e-25 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MT++RKDGHSSLYYLGP+ GPAPLHRQDCSHWCLPGVPD+WNELLYA+FLKRE+ NS Sbjct: 390 MTARRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPDTWNELLYALFLKREMTSKFNS 449 Query: 690 T 688 + Sbjct: 450 S 450 >ref|XP_006444099.1| protein trichome birefringence-like 10 isoform X2 [Citrus clementina] ref|XP_006479740.1| PREDICTED: protein trichome birefringence-like 10 isoform X2 [Citrus sinensis] gb|ESR57339.1| hypothetical protein CICLE_v10020003mg [Citrus clementina] Length = 473 Score = 115 bits (288), Expect = 2e-25 Identities = 50/67 (74%), Positives = 58/67 (86%) Frame = -1 Query: 870 MTSQRKDGHSSLYYLGPETGPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRELALTRNS 691 MTS+RKDGHSS+Y LGP+ GPAPLHRQDCSHWCLPG+PDSWNELLYA+FLK+E + +NS Sbjct: 406 MTSRRKDGHSSVYLLGPKRGPAPLHRQDCSHWCLPGIPDSWNELLYALFLKQETSHAQNS 465 Query: 690 TEPFHAP 670 E AP Sbjct: 466 VEHPQAP 472