BLASTX nr result
ID: Acanthopanax23_contig00020285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00020285 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21707.1| Ferric reductase-like protein [Handroanthus impet... 66 2e-10 gb|PIN17860.1| Ferric reductase-like protein [Handroanthus impet... 66 2e-10 ref|XP_017236545.1| PREDICTED: vesicle transport protein GOT1B [... 65 6e-10 gb|PON63175.1| Vesicle transport protein, Got1/SFT2-like, partia... 64 7e-10 ref|XP_011073778.1| vesicle transport protein GOT1 isoform X3 [S... 64 9e-10 ref|XP_015901035.1| PREDICTED: vesicle transport protein GOT1B-l... 64 1e-09 ref|XP_015900259.1| PREDICTED: vesicle transport protein GOT1B-l... 64 1e-09 ref|XP_022852819.1| vesicle transport protein GOT1 isoform X3 [O... 64 1e-09 ref|XP_022852817.1| vesicle transport protein GOT1 isoform X2 [O... 64 1e-09 ref|XP_011073777.1| vesicle transport protein GOT1 isoform X2 [S... 64 1e-09 ref|XP_022852816.1| vesicle transport protein GOT1 isoform X1 [O... 64 1e-09 ref|XP_021648312.1| vesicle transport protein GOT1 [Hevea brasil... 64 1e-09 ref|XP_011073776.1| vesicle transport protein GOT1 isoform X1 [S... 64 1e-09 ref|XP_010650463.1| PREDICTED: vesicle transport protein GOT1 is... 62 3e-09 ref|XP_019075249.1| PREDICTED: vesicle transport protein GOT1 is... 62 3e-09 ref|XP_010999983.1| PREDICTED: vesicle transport protein GOT1B [... 63 4e-09 gb|KYP65066.1| Vesicle transport protein GOT1A [Cajanus cajan] 63 4e-09 gb|PON49382.1| Vesicle transport protein, Got1/SFT2-like, partia... 62 4e-09 emb|CDP14661.1| unnamed protein product [Coffea canephora] 62 4e-09 ref|XP_019172531.1| PREDICTED: vesicle transport protein GOT1 is... 62 4e-09 >gb|PIN21707.1| Ferric reductase-like protein [Handroanthus impetiginosus] Length = 135 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGVA+LL WRSTLQLF NR NYK Sbjct: 32 DRGLLALGNIFWLAGVAILLGWRSTLQLFTNRRNYK 67 >gb|PIN17860.1| Ferric reductase-like protein [Handroanthus impetiginosus] Length = 135 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGVA+LL WRSTLQLF NR NYK Sbjct: 32 DRGLLALGNIFWLAGVAILLGWRSTLQLFTNRRNYK 67 >ref|XP_017236545.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236546.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236547.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236548.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236549.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236550.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236551.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236552.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236554.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] ref|XP_017236555.1| PREDICTED: vesicle transport protein GOT1B [Daucus carota subsp. sativus] gb|KZN04700.1| hypothetical protein DCAR_005537 [Daucus carota subsp. sativus] Length = 134 Score = 64.7 bits (156), Expect = 6e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLAL NIFFLAGV LLLSWRSTLQLF +ANYK Sbjct: 32 DRGLLALANIFFLAGVVLLLSWRSTLQLFTTKANYK 67 >gb|PON63175.1| Vesicle transport protein, Got1/SFT2-like, partial [Trema orientalis] Length = 125 Score = 64.3 bits (155), Expect = 7e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L+GVALLL WRSTL+LF N+ANYK Sbjct: 32 DRGLLALGNIFWLSGVALLLGWRSTLKLFTNQANYK 67 >ref|XP_011073778.1| vesicle transport protein GOT1 isoform X3 [Sesamum indicum] Length = 135 Score = 64.3 bits (155), Expect = 9e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L GVA+LL WRSTLQLF NR NYK Sbjct: 32 DRGLLALGNIFWLTGVAILLGWRSTLQLFTNRRNYK 67 >ref|XP_015901035.1| PREDICTED: vesicle transport protein GOT1B-like isoform X1 [Ziziphus jujuba] ref|XP_015901036.1| PREDICTED: vesicle transport protein GOT1B-like isoform X1 [Ziziphus jujuba] ref|XP_015901037.1| PREDICTED: vesicle transport protein GOT1B-like isoform X1 [Ziziphus jujuba] ref|XP_015901038.1| PREDICTED: vesicle transport protein GOT1B-like isoform X2 [Ziziphus jujuba] ref|XP_015901039.1| PREDICTED: vesicle transport protein GOT1B-like isoform X2 [Ziziphus jujuba] Length = 124 Score = 63.9 bits (154), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGVALLL WRS L+LF NRANYK Sbjct: 32 DRGLLALGNIFWLAGVALLLGWRSMLRLFINRANYK 67 >ref|XP_015900259.1| PREDICTED: vesicle transport protein GOT1B-like [Ziziphus jujuba] ref|XP_015900260.1| PREDICTED: vesicle transport protein GOT1B-like [Ziziphus jujuba] Length = 124 Score = 63.9 bits (154), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGVALLL WRS L+LF NRANYK Sbjct: 32 DRGLLALGNIFWLAGVALLLGWRSMLRLFINRANYK 67 >ref|XP_022852819.1| vesicle transport protein GOT1 isoform X3 [Olea europaea var. sylvestris] Length = 127 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGV LLL WRSTL LF NR+NYK Sbjct: 32 DRGLLALGNIFWLAGVVLLLGWRSTLNLFTNRSNYK 67 >ref|XP_022852817.1| vesicle transport protein GOT1 isoform X2 [Olea europaea var. sylvestris] Length = 129 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGV LLL WRSTL LF NR+NYK Sbjct: 32 DRGLLALGNIFWLAGVVLLLGWRSTLNLFTNRSNYK 67 >ref|XP_011073777.1| vesicle transport protein GOT1 isoform X2 [Sesamum indicum] Length = 147 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L GVA+LL WRSTLQLF NR NYK Sbjct: 48 DRGLLALGNIFWLTGVAILLGWRSTLQLFTNRRNYK 83 >ref|XP_022852816.1| vesicle transport protein GOT1 isoform X1 [Olea europaea var. sylvestris] Length = 135 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGV LLL WRSTL LF NR+NYK Sbjct: 32 DRGLLALGNIFWLAGVVLLLGWRSTLNLFTNRSNYK 67 >ref|XP_021648312.1| vesicle transport protein GOT1 [Hevea brasiliensis] Length = 135 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+LAGVA+LL WRSTL +F N+ANYK Sbjct: 32 DRGLLALGNIFWLAGVAILLGWRSTLNIFTNKANYK 67 >ref|XP_011073776.1| vesicle transport protein GOT1 isoform X1 [Sesamum indicum] Length = 151 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L GVA+LL WRSTLQLF NR NYK Sbjct: 48 DRGLLALGNIFWLTGVAILLGWRSTLQLFTNRRNYK 83 >ref|XP_010650463.1| PREDICTED: vesicle transport protein GOT1 isoform X3 [Vitis vinifera] Length = 101 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L GVALL+ WRST LF NRANYK Sbjct: 32 DRGLLALGNIFWLTGVALLIGWRSTWNLFSNRANYK 67 >ref|XP_019075249.1| PREDICTED: vesicle transport protein GOT1 isoform X2 [Vitis vinifera] Length = 104 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L GVALL+ WRST LF NRANYK Sbjct: 32 DRGLLALGNIFWLTGVALLIGWRSTWNLFSNRANYK 67 >ref|XP_010999983.1| PREDICTED: vesicle transport protein GOT1B [Populus euphratica] Length = 135 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L+GVA+LL WRST +LF NRANYK Sbjct: 32 DRGLLALGNIFWLSGVAILLGWRSTWKLFTNRANYK 67 >gb|KYP65066.1| Vesicle transport protein GOT1A [Cajanus cajan] Length = 154 Score = 63.2 bits (152), Expect = 4e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYKPL 245 DRGLLALGNIF LAGVA+LL WRST LF NRANYK L Sbjct: 32 DRGLLALGNIFSLAGVAILLGWRSTWALFTNRANYKAL 69 >gb|PON49382.1| Vesicle transport protein, Got1/SFT2-like, partial [Parasponia andersonii] Length = 125 Score = 62.4 bits (150), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNIF+L+GVALLL W STL+LF N+ANYK Sbjct: 32 DRGLLALGNIFWLSGVALLLGWHSTLKLFTNQANYK 67 >emb|CDP14661.1| unnamed protein product [Coffea canephora] Length = 126 Score = 62.4 bits (150), Expect = 4e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNI +LAGVALLL WRSTLQLF +R NYK Sbjct: 32 DRGLLALGNILWLAGVALLLGWRSTLQLFTDRRNYK 67 >ref|XP_019172531.1| PREDICTED: vesicle transport protein GOT1 isoform X4 [Ipomoea nil] Length = 128 Score = 62.4 bits (150), Expect = 4e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 132 DRGLLALGNIFFLAGVALLLSWRSTLQLFPNRANYK 239 DRGLLALGNI +LAGV+LLL WRSTLQ+F NR NYK Sbjct: 32 DRGLLALGNILWLAGVSLLLGWRSTLQIFTNRMNYK 67