BLASTX nr result
ID: Acanthopanax23_contig00020159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00020159 (696 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA03881.1| Cu/Zn superoxide dismutase, partial [Citrus sine... 39 9e-06 >emb|CAA03881.1| Cu/Zn superoxide dismutase, partial [Citrus sinensis] Length = 126 Score = 39.3 bits (90), Expect(2) = 9e-06 Identities = 14/29 (48%), Positives = 24/29 (82%) Frame = +2 Query: 275 SILGRTIVLYSKSNPNPGDPLAWGVIGVA 361 S++GR +V++S +P+PGD +AWG IG++ Sbjct: 97 SVIGRGLVVHSSPSPDPGDGVAWGTIGLS 125 Score = 38.9 bits (89), Expect(2) = 9e-06 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +1 Query: 73 EGTIAFTQEDSNYVAINIKIKGIPQEFHALHIKTYGHISGGIALSEPTFRDLG 231 +GT++F+ E S + + G+P HAL I TYG+IS + P F+ G Sbjct: 14 KGTVSFSVEGSGPTTVKGSLSGLPPGDHALIIHTYGNISNDWISTGPPFKPAG 66