BLASTX nr result
ID: Acanthopanax23_contig00020038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00020038 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017230568.1| PREDICTED: uncharacterized protein LOC108205... 56 4e-06 >ref|XP_017230568.1| PREDICTED: uncharacterized protein LOC108205219 [Daucus carota subsp. sativus] gb|KZN10982.1| hypothetical protein DCAR_003638 [Daucus carota subsp. sativus] Length = 402 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 2 AETNVPTEYSFARIADDARSVYLGAKVVFCQSML 103 AE+NVP EY+ A IADDARSVY GAK VFC+SML Sbjct: 369 AESNVPAEYNLASIADDARSVYSGAKAVFCKSML 402