BLASTX nr result
ID: Acanthopanax23_contig00019738
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00019738 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM25339.1| hypothetical protein LR48_Vigan98s000600 [Vigna a... 55 2e-06 >gb|KOM25339.1| hypothetical protein LR48_Vigan98s000600 [Vigna angularis] Length = 166 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 41 LLSVF*CARNCLKVKDIIGRRPSEDSCVIGDR 136 LL++F CARNCLKVKDIIGR PSEDS VIG R Sbjct: 35 LLAIFRCARNCLKVKDIIGRWPSEDSSVIGHR 66