BLASTX nr result
ID: Acanthopanax23_contig00019641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00019641 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022883602.1| splicing factor U2af small subunit B-like is... 82 1e-15 ref|XP_009760036.1| PREDICTED: splicing factor U2af small subuni... 82 3e-15 ref|XP_009616753.1| PREDICTED: splicing factor U2af small subuni... 80 9e-15 ref|XP_019161995.1| PREDICTED: splicing factor U2af small subuni... 80 1e-14 ref|XP_019236416.1| PREDICTED: splicing factor U2af small subuni... 79 2e-14 ref|XP_006349078.1| PREDICTED: splicing factor U2af small subuni... 79 2e-14 ref|XP_017247706.1| PREDICTED: splicing factor U2af small subuni... 79 4e-14 ref|XP_010243574.1| PREDICTED: splicing factor U2af small subuni... 77 1e-13 ref|XP_022898506.1| splicing factor U2af small subunit B-like [O... 77 2e-13 ref|XP_018833184.1| PREDICTED: splicing factor U2af small subuni... 77 2e-13 gb|OVA17868.1| RNA recognition motif domain [Macleaya cordata] 77 2e-13 gb|PHT35096.1| Splicing factor U2af small subunit A [Capsicum ba... 76 2e-13 ref|XP_004251010.1| PREDICTED: splicing factor U2af small subuni... 76 2e-13 ref|XP_019247316.1| PREDICTED: splicing factor U2af small subuni... 75 5e-13 ref|XP_011090000.1| splicing factor U2af small subunit B-like [S... 75 5e-13 gb|PHU03748.1| Splicing factor U2af small subunit A [Capsicum ch... 75 6e-13 gb|PHT69140.1| Splicing factor U2af small subunit A [Capsicum an... 75 6e-13 ref|XP_016547549.1| PREDICTED: splicing factor U2af small subuni... 75 6e-13 gb|KVH99924.1| Nucleotide-binding, alpha-beta plait [Cynara card... 75 1e-12 gb|OVA04640.1| RNA recognition motif domain [Macleaya cordata] 75 1e-12 >ref|XP_022883602.1| splicing factor U2af small subunit B-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022883605.1| splicing factor U2af small subunit B-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022883612.1| splicing factor U2af small subunit B-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022883614.1| splicing factor U2af small subunit B-like isoform X2 [Olea europaea var. sylvestris] Length = 314 Score = 82.4 bits (202), Expect = 1e-15 Identities = 42/66 (63%), Positives = 49/66 (74%), Gaps = 2/66 (3%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNK--ATGMIHENEGDYDGHMQNGDQYYNQ 387 +R RSP+R+GSEERRAKIEQWNREKE AE +K A G NE D +G +QNGDQYY Q Sbjct: 249 RRDRSPVREGSEERRAKIEQWNREKEEAERSDKVNAGGADDRNENDDNGDVQNGDQYYAQ 308 Query: 388 LQPEQS 405 P+QS Sbjct: 309 EPPQQS 314 >ref|XP_009760036.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana sylvestris] ref|XP_009760037.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana sylvestris] ref|XP_009760038.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana sylvestris] ref|XP_016458606.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] ref|XP_016458607.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] ref|XP_016458608.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] Length = 309 Score = 81.6 bits (200), Expect = 3e-15 Identities = 38/58 (65%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKAT-GMIHENEGDYDGHMQNGDQYYN 384 +R RSP+RDGSEERRA+IEQWNREKELAEL N+A ++NE + +G++QN DQYYN Sbjct: 252 RRDRSPVRDGSEERRARIEQWNREKELAELANRANEDSTYKNENNENGYVQNQDQYYN 309 >ref|XP_009616753.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tomentosiformis] ref|XP_009616754.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tomentosiformis] ref|XP_009616755.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tomentosiformis] ref|XP_016467277.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] ref|XP_016467278.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] ref|XP_016467279.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana tabacum] Length = 306 Score = 80.1 bits (196), Expect = 9e-15 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQ 387 +R RSPIRDGSEERRA+IEQWNREKELA GN+ + ++NE + +G++QN DQYYNQ Sbjct: 250 RRDRSPIRDGSEERRARIEQWNREKELANRGNEDSS--NKNENNENGYVQNPDQYYNQ 305 >ref|XP_019161995.1| PREDICTED: splicing factor U2af small subunit B-like [Ipomoea nil] ref|XP_019161996.1| PREDICTED: splicing factor U2af small subunit B-like [Ipomoea nil] Length = 320 Score = 80.1 bits (196), Expect = 1e-14 Identities = 42/92 (45%), Positives = 55/92 (59%), Gaps = 3/92 (3%) Frame = +1 Query: 151 SRRYKXXXXXXXXXXXXXXXTKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMI- 327 SRR++ +R RSP+RDGSEERRA+IEQWNREKE A+L A + Sbjct: 229 SRRHRSTSPGHRKGRSRSPGGRRERSPVRDGSEERRARIEQWNREKEQADLAKNANAEVL 288 Query: 328 -HENEGDYDGHMQNGDQYYNQLQPEQ-SGYQY 417 H++E + G+ Q+ DQYY Q P Q +GY Y Sbjct: 289 DHKSENNERGYAQDEDQYYGQQHPSQRNGYAY 320 >ref|XP_019236416.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana attenuata] ref|XP_019236417.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana attenuata] ref|XP_019236418.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana attenuata] gb|OIT23226.1| splicing factor u2af small subunit b [Nicotiana attenuata] Length = 311 Score = 79.3 bits (194), Expect = 2e-14 Identities = 37/59 (62%), Positives = 47/59 (79%), Gaps = 1/59 (1%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKAT-GMIHENEGDYDGHMQNGDQYYNQ 387 +R RSP+RDGSEERRA+IEQWNREKELA+L N+ ++NE + +G+ QN DQYYNQ Sbjct: 252 RRDRSPVRDGSEERRARIEQWNREKELADLANRGNEDSRYKNENNENGYAQNQDQYYNQ 310 >ref|XP_006349078.1| PREDICTED: splicing factor U2af small subunit B-like [Solanum tuberosum] ref|XP_015164943.1| PREDICTED: splicing factor U2af small subunit B-like [Solanum tuberosum] Length = 309 Score = 79.0 bits (193), Expect = 2e-14 Identities = 38/59 (64%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATG-MIHENEGDYDGHMQNGDQYYNQ 387 +R RSP+RDGSEERRA+IEQWNREKE AELGN+A ++NE + +G N DQYYNQ Sbjct: 250 RRDRSPVRDGSEERRARIEQWNREKEQAELGNRANADSNYKNESNRNGSAPNQDQYYNQ 308 >ref|XP_017247706.1| PREDICTED: splicing factor U2af small subunit B-like [Daucus carota subsp. sativus] ref|XP_017247707.1| PREDICTED: splicing factor U2af small subunit B-like [Daucus carota subsp. sativus] ref|XP_017247708.1| PREDICTED: splicing factor U2af small subunit B-like [Daucus carota subsp. sativus] gb|KZM97157.1| hypothetical protein DCAR_015481 [Daucus carota subsp. sativus] Length = 313 Score = 78.6 bits (192), Expect = 4e-14 Identities = 39/86 (45%), Positives = 51/86 (59%) Frame = +1 Query: 154 RRYKXXXXXXXXXXXXXXXTKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHE 333 R+Y+ ++HRSP+R+GSEERRAKIEQWNRE++ AEL M E Sbjct: 229 RKYRSISPERRSGRSRSPGARKHRSPVREGSEERRAKIEQWNRERDQAELAKHT--MTGE 286 Query: 334 NEGDYDGHMQNGDQYYNQLQPEQSGY 411 + DY+G NGD Y++Q E SGY Sbjct: 287 HGMDYEGQKHNGDHYHHQHPREDSGY 312 >ref|XP_010243574.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo nucifera] ref|XP_010243584.1| PREDICTED: splicing factor U2af small subunit B-like [Nelumbo nucifera] Length = 323 Score = 77.4 bits (189), Expect = 1e-13 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQLQ 393 +R+RSP+R+GS ERRAKIEQWNRE+E AE GNK N + +G+ +NG +YYN+ Q Sbjct: 253 RRNRSPVREGSAERRAKIEQWNREREQAEAGNKDNIESAPNNNESNGYDENGGEYYNEQQ 312 Query: 394 ---PEQSGYQY 417 P+Q Y Y Sbjct: 313 QQPPQQGTYHY 323 >ref|XP_022898506.1| splicing factor U2af small subunit B-like [Olea europaea var. sylvestris] ref|XP_022898507.1| splicing factor U2af small subunit B-like [Olea europaea var. sylvestris] ref|XP_022898508.1| splicing factor U2af small subunit B-like [Olea europaea var. sylvestris] Length = 321 Score = 76.6 bits (187), Expect = 2e-13 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 2/70 (2%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREK-ELAELGNKATGMIH-ENEGDYDGHMQNGDQYYNQ 387 KR+ SP+R+GSEERRAKIEQWNRE+ E A N TG++ +NE D +G+M NG+Q+ ++ Sbjct: 252 KRYHSPVREGSEERRAKIEQWNREREEAARSNNPNTGVVDGKNEKDNNGYMHNGNQHDSE 311 Query: 388 LQPEQSGYQY 417 P+QS Y Y Sbjct: 312 KAPQQSRYGY 321 >ref|XP_018833184.1| PREDICTED: splicing factor U2af small subunit B-like [Juglans regia] ref|XP_018833185.1| PREDICTED: splicing factor U2af small subunit B-like [Juglans regia] ref|XP_018833186.1| PREDICTED: splicing factor U2af small subunit B-like [Juglans regia] ref|XP_018833187.1| PREDICTED: splicing factor U2af small subunit B-like [Juglans regia] Length = 326 Score = 76.6 bits (187), Expect = 2e-13 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 5/73 (6%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIH--ENEGDYDGHMQNGDQY--- 378 +R+ SPIR+GSEERRAKIEQWNRE+E + + ++ + + N+G Y+GH+QNGDQY Sbjct: 254 RRNHSPIREGSEERRAKIEQWNREREQHQQQDNSSKIDNYGNNDGSYNGHVQNGDQYDDC 313 Query: 379 YNQLQPEQSGYQY 417 Q P Q GY Y Sbjct: 314 QQQRSPLQEGYNY 326 >gb|OVA17868.1| RNA recognition motif domain [Macleaya cordata] Length = 331 Score = 76.6 bits (187), Expect = 2e-13 Identities = 38/75 (50%), Positives = 47/75 (62%), Gaps = 7/75 (9%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQLQ 393 +R+RSPIR+GS ERRAKIEQWNREKE + G K N D +G+ QN QYY+Q Q Sbjct: 257 RRNRSPIREGSAERRAKIEQWNREKEQTDTGPKNDNRTSNNNNDSNGYEQNEGQYYDQQQ 316 Query: 394 -------PEQSGYQY 417 P++ GY Y Sbjct: 317 LPPPPPPPQEGGYDY 331 >gb|PHT35096.1| Splicing factor U2af small subunit A [Capsicum baccatum] Length = 303 Score = 76.3 bits (186), Expect = 2e-13 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +1 Query: 211 TKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQ 387 ++R RSP+RDGSEERRA+IEQWNREKE AEL N A +EN G QN DQYYNQ Sbjct: 249 SRRDRSPVRDGSEERRARIEQWNREKEQAELANAANAYSNEN-----GSAQNQDQYYNQ 302 >ref|XP_004251010.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum] ref|XP_010313325.1| PREDICTED: splicing factor U2af small subunit B [Solanum lycopersicum] ref|XP_015058644.1| PREDICTED: splicing factor U2af small subunit B [Solanum pennellii] ref|XP_015058646.1| PREDICTED: splicing factor U2af small subunit B [Solanum pennellii] Length = 309 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/59 (62%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATG-MIHENEGDYDGHMQNGDQYYNQ 387 +R RSP+RDGSEERRA+IEQWNREKE AEL N+A ++NE + +G N DQYYNQ Sbjct: 250 RRDRSPVRDGSEERRARIEQWNREKEQAELDNRANADSNYKNESNENGSAPNQDQYYNQ 308 >ref|XP_019247316.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana attenuata] ref|XP_019247320.1| PREDICTED: splicing factor U2af small subunit B-like [Nicotiana attenuata] gb|OIT08108.1| splicing factor u2af small subunit a [Nicotiana attenuata] Length = 320 Score = 75.5 bits (184), Expect = 5e-13 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNK--ATGMIHENEGDYDGHMQNGDQYYNQ 387 +R RSP RD SEERRA+IEQWNREKE AEL NK A G+ + +E + G+ QNG+ Y +Q Sbjct: 251 RRDRSPTRDSSEERRARIEQWNREKEEAELTNKTNAVGINYNDESNEHGYAQNGNGYNDQ 310 Query: 388 LQPEQSGY 411 +Q+GY Sbjct: 311 QPSQQNGY 318 >ref|XP_011090000.1| splicing factor U2af small subunit B-like [Sesamum indicum] ref|XP_011090001.1| splicing factor U2af small subunit B-like [Sesamum indicum] ref|XP_020552413.1| splicing factor U2af small subunit B-like [Sesamum indicum] Length = 320 Score = 75.5 bits (184), Expect = 5e-13 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 2/70 (2%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKAT--GMIHENEGDYDGHMQNGDQYYNQ 387 +R RSP+R+GSEERRAKI QWNREKE AE +KA G + + E D G++++GD Q Sbjct: 251 RRDRSPVREGSEERRAKIAQWNREKEEAERASKANAGGDVDKKENDNHGYVESGDHNRGQ 310 Query: 388 LQPEQSGYQY 417 P+Q+GY Y Sbjct: 311 DPPQQNGYGY 320 >gb|PHU03748.1| Splicing factor U2af small subunit A [Capsicum chinense] Length = 303 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +1 Query: 211 TKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQ 387 ++R RSP+RDGSEERRA+IEQWNREKE AEL N A +EN G QN DQYYNQ Sbjct: 249 SRRDRSPVRDGSEERRARIEQWNREKEQAELANGANAGSNEN-----GSAQNQDQYYNQ 302 >gb|PHT69140.1| Splicing factor U2af small subunit A [Capsicum annuum] Length = 303 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +1 Query: 211 TKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQ 387 ++R RSP+RDGSEERRA+IEQWNREKE AEL N A +EN G QN DQYYNQ Sbjct: 249 SRRDRSPVRDGSEERRARIEQWNREKEQAELANGANADSNEN-----GSAQNQDQYYNQ 302 >ref|XP_016547549.1| PREDICTED: splicing factor U2af small subunit B-like [Capsicum annuum] Length = 303 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +1 Query: 211 TKRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEGDYDGHMQNGDQYYNQ 387 ++R RSP+RDGSEERRA+IEQWNREKE AEL N A +EN G QN DQYYNQ Sbjct: 249 SRRDRSPVRDGSEERRARIEQWNREKEQAELANGANADSNEN-----GSAQNQDQYYNQ 302 >gb|KVH99924.1| Nucleotide-binding, alpha-beta plait [Cynara cardunculus var. scolymus] Length = 327 Score = 74.7 bits (182), Expect = 1e-12 Identities = 39/74 (52%), Positives = 47/74 (63%), Gaps = 6/74 (8%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELGNKATGMIHENEG-DYDGHMQNGDQYY--- 381 KR+RSP+R+GS ERRAKIEQWNREKE ++ G K N+G + DG QNGD YY Sbjct: 254 KRNRSPVREGSAERRAKIEQWNREKEQSKTGPKTASSNENNDGINDDGAPQNGDHYYEPH 313 Query: 382 --NQLQPEQSGYQY 417 Q Q + GY Y Sbjct: 314 QEKQPQQDDGGYDY 327 >gb|OVA04640.1| RNA recognition motif domain [Macleaya cordata] Length = 408 Score = 75.1 bits (183), Expect = 1e-12 Identities = 41/71 (57%), Positives = 47/71 (66%), Gaps = 3/71 (4%) Frame = +1 Query: 214 KRHRSPIRDGSEERRAKIEQWNREKELAELG-NKATGMIHENEGDYDGH-MQNGDQYY-N 384 KR RSP+R+GS ERRAKIEQWNREKE E G N T + N D G+ QNGDQYY Sbjct: 335 KRIRSPVREGSAERRAKIEQWNREKEQTESGHNNNTNATNINNNDSSGYGAQNGDQYYEQ 394 Query: 385 QLQPEQSGYQY 417 Q QP + GY + Sbjct: 395 QQQPHRGGYDH 405