BLASTX nr result
ID: Acanthopanax23_contig00019416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00019416 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021284383.1| transcription initiation factor TFIID subuni... 79 3e-14 ref|XP_021284382.1| transcription initiation factor TFIID subuni... 79 3e-14 ref|XP_021284381.1| transcription initiation factor TFIID subuni... 79 3e-14 ref|XP_021284380.1| transcription initiation factor TFIID subuni... 79 3e-14 gb|EOY15762.1| TBP-associated factor 4, putative isoform 2 [Theo... 78 5e-14 ref|XP_007018538.2| PREDICTED: transcription initiation factor T... 78 5e-14 ref|XP_007018536.2| PREDICTED: transcription initiation factor T... 78 5e-14 gb|EOY15761.1| TBP-associated factor 4, putative isoform 1 [Theo... 78 5e-14 dbj|GAY47957.1| hypothetical protein CUMW_108370 [Citrus unshiu] 78 5e-14 gb|KDO81553.1| hypothetical protein CISIN_1g048675mg [Citrus sin... 78 5e-14 ref|XP_006433616.1| transcription initiation factor TFIID subuni... 78 5e-14 ref|XP_006472283.1| PREDICTED: transcription initiation factor T... 78 5e-14 ref|XP_015384185.1| PREDICTED: transcription initiation factor T... 78 5e-14 ref|XP_017247257.1| PREDICTED: transcription initiation factor T... 77 8e-14 gb|KZM99829.1| hypothetical protein DCAR_012809 [Daucus carota s... 77 8e-14 ref|XP_017247256.1| PREDICTED: transcription initiation factor T... 77 9e-14 ref|XP_017247255.1| PREDICTED: transcription initiation factor T... 77 9e-14 ref|XP_017247254.1| PREDICTED: transcription initiation factor T... 77 9e-14 ref|XP_023925689.1| transcription initiation factor TFIID subuni... 77 9e-14 ref|XP_023925688.1| transcription initiation factor TFIID subuni... 77 9e-14 >ref|XP_021284383.1| transcription initiation factor TFIID subunit 4b isoform X4 [Herrania umbratica] Length = 854 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 798 GASRKFGRNQVVTPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 854 >ref|XP_021284382.1| transcription initiation factor TFIID subunit 4b isoform X3 [Herrania umbratica] Length = 948 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 892 GASRKFGRNQVVTPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 948 >ref|XP_021284381.1| transcription initiation factor TFIID subunit 4b isoform X2 [Herrania umbratica] Length = 949 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 893 GASRKFGRNQVVTPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 949 >ref|XP_021284380.1| transcription initiation factor TFIID subunit 4b isoform X1 [Herrania umbratica] Length = 950 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 894 GASRKFGRNQVVTPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 950 >gb|EOY15762.1| TBP-associated factor 4, putative isoform 2 [Theobroma cacao] Length = 944 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 888 GASRKFGRNQVITPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 944 >ref|XP_007018538.2| PREDICTED: transcription initiation factor TFIID subunit 4b isoform X2 [Theobroma cacao] Length = 949 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 893 GASRKFGRNQVITPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 949 >ref|XP_007018536.2| PREDICTED: transcription initiation factor TFIID subunit 4b isoform X1 [Theobroma cacao] Length = 950 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 894 GASRKFGRNQVITPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 950 >gb|EOY15761.1| TBP-associated factor 4, putative isoform 1 [Theobroma cacao] Length = 950 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 GA +KFGR QV Q+ V R+IS+KDVIAVLEREPQ SKSTLI+RLY+K+R++A A+ Sbjct: 894 GASRKFGRNQVITPQTRVARTISVKDVIAVLEREPQMSKSTLIYRLYEKIRSEAAAE 950 >dbj|GAY47957.1| hypothetical protein CUMW_108370 [Citrus unshiu] Length = 954 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 G+ +KFG+TQ T+SQ+ V R+I++KDVIAVLEREPQ SKSTLI+RLY+KV +DA A+ Sbjct: 898 GSGRKFGKTQATVSQTKVARAITVKDVIAVLEREPQMSKSTLIYRLYEKVSSDASAE 954 >gb|KDO81553.1| hypothetical protein CISIN_1g048675mg [Citrus sinensis] Length = 954 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 G+ +KFG+TQ T+SQ+ V R+I++KDVIAVLEREPQ SKSTLI+RLY+KV +DA A+ Sbjct: 898 GSGRKFGKTQATVSQTKVARAITVKDVIAVLEREPQMSKSTLIYRLYEKVSSDASAE 954 >ref|XP_006433616.1| transcription initiation factor TFIID subunit 4b [Citrus clementina] gb|ESR46856.1| hypothetical protein CICLE_v10000177mg [Citrus clementina] Length = 954 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 G+ +KFG+TQ T+SQ+ V R+I++KDVIAVLEREPQ SKSTLI+RLY+KV +DA A+ Sbjct: 898 GSGRKFGKTQATVSQTKVARAITVKDVIAVLEREPQMSKSTLIYRLYEKVSSDASAE 954 >ref|XP_006472283.1| PREDICTED: transcription initiation factor TFIID subunit 4b isoform X2 [Citrus sinensis] Length = 955 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVA 168 G+ +KFG+TQ T+SQ+ V R+I++KDVIAVLEREPQ SKSTLI+RLY+KV +DA A Sbjct: 898 GSGRKFGKTQATVSQTKVARAITVKDVIAVLEREPQMSKSTLIYRLYEKVSSDAAA 953 >ref|XP_015384185.1| PREDICTED: transcription initiation factor TFIID subunit 4b isoform X1 [Citrus sinensis] Length = 958 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVA 168 G+ +KFG+TQ T+SQ+ V R+I++KDVIAVLEREPQ SKSTLI+RLY+KV +DA A Sbjct: 901 GSGRKFGKTQATVSQTKVARAITVKDVIAVLEREPQMSKSTLIYRLYEKVSSDAAA 956 >ref|XP_017247257.1| PREDICTED: transcription initiation factor TFIID subunit 4b-like isoform X4 [Daucus carota subsp. sativus] Length = 798 Score = 77.4 bits (189), Expect = 8e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAV 165 G +K G+ QV MSQ G+PR+IS+KDVIAVLEREPQTSKS LI+RLY+KV TDA+ Sbjct: 744 GVTRKSGKAQV-MSQPGIPRNISVKDVIAVLEREPQTSKSVLIYRLYNKVHTDAM 797 >gb|KZM99829.1| hypothetical protein DCAR_012809 [Daucus carota subsp. sativus] Length = 820 Score = 77.4 bits (189), Expect = 8e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAV 165 G +K G+ QV MSQ G+PR+IS+KDVIAVLEREPQTSKS LI+RLY+KV TDA+ Sbjct: 766 GVTRKSGKAQV-MSQPGIPRNISVKDVIAVLEREPQTSKSVLIYRLYNKVHTDAM 819 >ref|XP_017247256.1| PREDICTED: transcription initiation factor TFIID subunit 4b-like isoform X3 [Daucus carota subsp. sativus] Length = 853 Score = 77.4 bits (189), Expect = 9e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAV 165 G +K G+ QV MSQ G+PR+IS+KDVIAVLEREPQTSKS LI+RLY+KV TDA+ Sbjct: 799 GVTRKSGKAQV-MSQPGIPRNISVKDVIAVLEREPQTSKSVLIYRLYNKVHTDAM 852 >ref|XP_017247255.1| PREDICTED: transcription initiation factor TFIID subunit 4b-like isoform X2 [Daucus carota subsp. sativus] Length = 853 Score = 77.4 bits (189), Expect = 9e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAV 165 G +K G+ QV MSQ G+PR+IS+KDVIAVLEREPQTSKS LI+RLY+KV TDA+ Sbjct: 799 GVTRKSGKAQV-MSQPGIPRNISVKDVIAVLEREPQTSKSVLIYRLYNKVHTDAM 852 >ref|XP_017247254.1| PREDICTED: transcription initiation factor TFIID subunit 4b-like isoform X1 [Daucus carota subsp. sativus] Length = 854 Score = 77.4 bits (189), Expect = 9e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAV 165 G +K G+ QV MSQ G+PR+IS+KDVIAVLEREPQTSKS LI+RLY+KV TDA+ Sbjct: 800 GVTRKSGKAQV-MSQPGIPRNISVKDVIAVLEREPQTSKSVLIYRLYNKVHTDAM 853 >ref|XP_023925689.1| transcription initiation factor TFIID subunit 4b isoform X2 [Quercus suber] gb|POE94202.1| isoform 2 of transcription initiation factor tfiid subunit 4b [Quercus suber] Length = 967 Score = 77.4 bits (189), Expect = 9e-14 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 G ++K GR Q+T++Q+ V RSISIKDVIAVLEREPQ S+S+LI+RLY++VR+DA A+ Sbjct: 911 GTVRKPGRNQITLAQTRVARSISIKDVIAVLEREPQMSRSSLIYRLYERVRSDATAE 967 >ref|XP_023925688.1| transcription initiation factor TFIID subunit 4b isoform X1 [Quercus suber] gb|POE94201.1| isoform 2 of transcription initiation factor tfiid subunit 4b [Quercus suber] Length = 968 Score = 77.4 bits (189), Expect = 9e-14 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 1 GALKKFGRTQVTMSQSGVPRSISIKDVIAVLEREPQTSKSTLIHRLYDKVRTDAVAD 171 G ++K GR Q+T++Q+ V RSISIKDVIAVLEREPQ S+S+LI+RLY++VR+DA A+ Sbjct: 912 GTVRKPGRNQITLAQTRVARSISIKDVIAVLEREPQMSRSSLIYRLYERVRSDATAE 968