BLASTX nr result
ID: Acanthopanax23_contig00019414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00019414 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021276473.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 64 3e-09 ref|XP_017983214.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 64 3e-09 ref|XP_021276474.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 64 3e-09 ref|XP_022749621.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 63 1e-08 ref|XP_010656516.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 63 1e-08 gb|OMO96020.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 62 1e-08 gb|OMO73186.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 62 1e-08 gb|EOY31210.1| Ubiquitin carboxyl-terminal hydrolase isoform 2 [... 62 1e-08 gb|EOY31209.1| Ubiquitin-specific protease 22 isoform 1 [Theobro... 62 1e-08 gb|POF10076.1| ubiquitin carboxyl-terminal hydrolase 22 [Quercus... 61 2e-08 gb|KZM97733.1| hypothetical protein DCAR_014905 [Daucus carota s... 62 2e-08 ref|XP_017244150.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 2e-08 ref|XP_022143038.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 62 2e-08 ref|XP_022730351.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 62 3e-08 ref|XP_022730346.1| ubiquitin carboxyl-terminal hydrolase 22-lik... 62 3e-08 ref|XP_008457196.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 3e-08 ref|XP_004139406.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 3e-08 ref|XP_008336962.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 3e-08 gb|PRQ46281.1| putative ubiquitinyl hydrolase 1 [Rosa chinensis] 60 3e-08 ref|XP_012464701.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 61 4e-08 >ref|XP_021276473.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Herrania umbratica] Length = 592 Score = 64.3 bits (155), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 553 TRVNENIVRAAQGYMMFYVQKMLYYKASEKQAA 585 >ref|XP_017983214.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22 [Theobroma cacao] Length = 592 Score = 64.3 bits (155), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 553 TRVNENIVRAAQGYMMFYVQKMLYYKASEKQAA 585 >ref|XP_021276474.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X2 [Herrania umbratica] Length = 640 Score = 64.3 bits (155), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 574 TRVNENIVRAAQGYMMFYVQKMLYYKASEKQAA 606 >ref|XP_022749621.1| ubiquitin carboxyl-terminal hydrolase 22-like [Durio zibethinus] Length = 588 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVN+ IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 555 TRVNDSIVRAAQGYMMFYVQKMLYYKASEKQAA 587 >ref|XP_010656516.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22 [Vitis vinifera] Length = 596 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKP 323 T+VNE+IVRAAQGYMMFYVQKMLYYKASEKP Sbjct: 563 TQVNENIVRAAQGYMMFYVQKMLYYKASEKP 593 >gb|OMO96020.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 [Corchorus olitorius] Length = 588 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 412 RVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 RVNE+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 556 RVNENIVRAAQGYMMFYVQKMLYYKASEKQAA 587 >gb|OMO73186.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 [Corchorus capsularis] Length = 588 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 412 RVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 RVNE+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 556 RVNENIVRAAQGYMMFYVQKMLYYKASEKQAA 587 >gb|EOY31210.1| Ubiquitin carboxyl-terminal hydrolase isoform 2 [Theobroma cacao] Length = 592 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRV+E+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 553 TRVDENIVRAAQGYMMFYVQKMLYYKASEKQAA 585 >gb|EOY31209.1| Ubiquitin-specific protease 22 isoform 1 [Theobroma cacao] Length = 640 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRV+E+IVRAAQGYMMFYVQKMLYYKASEK AA Sbjct: 574 TRVDENIVRAAQGYMMFYVQKMLYYKASEKQAA 606 >gb|POF10076.1| ubiquitin carboxyl-terminal hydrolase 22 [Quercus suber] Length = 235 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 T+VNE+IVRAAQGYMMFYVQKMLYYKASEK A Sbjct: 202 TQVNENIVRAAQGYMMFYVQKMLYYKASEKQVA 234 >gb|KZM97733.1| hypothetical protein DCAR_014905 [Daucus carota subsp. sativus] Length = 566 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAAL 314 TRVNE+IVR+AQGYMMFYVQK L+YKASEKP AL Sbjct: 533 TRVNENIVRSAQGYMMFYVQKTLFYKASEKPRAL 566 >ref|XP_017244150.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Daucus carota subsp. sativus] Length = 581 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAAL 314 TRVNE+IVR+AQGYMMFYVQK L+YKASEKP AL Sbjct: 548 TRVNENIVRSAQGYMMFYVQKTLFYKASEKPRAL 581 >ref|XP_022143038.1| ubiquitin carboxyl-terminal hydrolase 22-like [Momordica charantia] Length = 415 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 T+VNE+IVRAAQGYMMFYVQKMLYYKASEK +A Sbjct: 382 TQVNENIVRAAQGYMMFYVQKMLYYKASEKQSA 414 >ref|XP_022730351.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X2 [Durio zibethinus] Length = 584 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE IVRAAQGYMMFYVQKMLYYKASEK A Sbjct: 551 TRVNESIVRAAQGYMMFYVQKMLYYKASEKQDA 583 >ref|XP_022730346.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Durio zibethinus] ref|XP_022730347.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Durio zibethinus] ref|XP_022730348.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Durio zibethinus] ref|XP_022730350.1| ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Durio zibethinus] Length = 586 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE IVRAAQGYMMFYVQKMLYYKASEK A Sbjct: 553 TRVNESIVRAAQGYMMFYVQKMLYYKASEKQDA 585 >ref|XP_008457196.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Cucumis melo] Length = 602 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 T+VNE+IVRAAQGYMMFYVQKMLYYKASEK +A Sbjct: 569 TQVNENIVRAAQGYMMFYVQKMLYYKASEKQSA 601 >ref|XP_004139406.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Cucumis sativus] gb|KGN60716.1| hypothetical protein Csa_2G008080 [Cucumis sativus] Length = 602 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 T+VNE+IVRAAQGYMMFYVQKMLYYKASEK +A Sbjct: 569 TQVNENIVRAAQGYMMFYVQKMLYYKASEKQSA 601 >ref|XP_008336962.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Malus domestica] Length = 624 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPA 320 T+VNE+IVRAAQGYMMFYVQKML+YKASEKP+ Sbjct: 591 TQVNENIVRAAQGYMMFYVQKMLFYKASEKPS 622 >gb|PRQ46281.1| putative ubiquitinyl hydrolase 1 [Rosa chinensis] Length = 234 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEK 326 T+VNEDIVRAAQGYMMFYVQKML+YKASEK Sbjct: 201 TQVNEDIVRAAQGYMMFYVQKMLFYKASEK 230 >ref|XP_012464701.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Gossypium raimondii] gb|KJB83222.1| hypothetical protein B456_013G236100 [Gossypium raimondii] Length = 590 Score = 61.2 bits (147), Expect = 4e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 415 TRVNEDIVRAAQGYMMFYVQKMLYYKASEKPAA 317 TRVNE IV AAQGYMMFYVQKMLYYKASEK AA Sbjct: 551 TRVNESIVLAAQGYMMFYVQKMLYYKASEKQAA 583