BLASTX nr result
ID: Acanthopanax23_contig00018965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00018965 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus g... 80 2e-16 gb|OAO89260.1| hypothetical protein AXX17_ATUG02730 (mitochondri... 77 3e-15 gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Bet... 80 1e-14 gb|KJB09740.1| hypothetical protein B456_001G161600 [Gossypium r... 65 5e-10 gb|KFK27165.1| hypothetical protein AALP_AA8G343800 [Arabis alpina] 62 6e-10 gb|EEF45989.1| conserved hypothetical protein [Ricinus communis] 57 1e-07 >gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 80.5 bits (197), Expect = 2e-16 Identities = 60/120 (50%), Positives = 68/120 (56%), Gaps = 3/120 (2%) Frame = +2 Query: 68 KRGEATKWKASPARSNARLVDSEWSA*ALLEIGASTTR-ARKSSTERALSTKRSDLVLLA 244 +RG ATK KAS ARSNA L DSEWSA A LEIG + E L ++ + LL Sbjct: 3 ERGGATKLKASLARSNAHLGDSEWSAEAPLEIGGVLHELVSQVRNEPCLQSRATSACLLL 62 Query: 245 SGEASSTRE*AF*YGRNTTF*VDHYIEAIAKPSRIKASSPY-SNSKRPTYSLF-FFPRGL 418 + + + R YI AIAKPSRIKASSPY SNSKRPTYSLF FF L Sbjct: 63 AKLLELDNKHSSIVKRLLIRPTTTYIGAIAKPSRIKASSPYSSNSKRPTYSLFPFFSHNL 122 >gb|OAO89260.1| hypothetical protein AXX17_ATUG02730 (mitochondrion) [Arabidopsis thaliana] Length = 129 Score = 77.0 bits (188), Expect = 3e-15 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -2 Query: 424 PLKSPGEKEKAISRPFAVAIRAARLYTAWLRYRFYVVVDLKGSIPAILECLF 269 PLKSP + EKAISRPFA+A RAARLYTAWLRYR YVV+ LK IPAI F Sbjct: 78 PLKSPNKGEKAISRPFAIARRAARLYTAWLRYRSYVVIGLKSGIPAIQAYFF 129 >gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Beta vulgaris subsp. vulgaris] Length = 1629 Score = 80.5 bits (197), Expect = 1e-14 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -3 Query: 258 EASPEASKTRSLRFVDKARSVLDLRARVVLAPISKRAYALHSLSTKRAFERA 103 E SPEASKTRSL FVDKARSVLDL+ARVVLA ISK AYAL+ LSTKRA ERA Sbjct: 1236 EVSPEASKTRSLCFVDKARSVLDLQARVVLASISKGAYALYLLSTKRALERA 1287 >gb|KJB09740.1| hypothetical protein B456_001G161600 [Gossypium raimondii] Length = 189 Score = 65.1 bits (157), Expect = 5e-10 Identities = 40/66 (60%), Positives = 42/66 (63%) Frame = -2 Query: 391 ISRPFAVAIRAARLYTAWLRYRFYVVVDLKGSIPAILECLFSSARSFARSKQDEVAPLRR 212 +S PFA+AIRAARLYTAWL YR YVVV ARSFA SKQDEV RR Sbjct: 141 MSLPFAIAIRAARLYTAWLCYRSYVVV--------------GHARSFASSKQDEV---RR 183 Query: 211 QGPFRT 194 QG FRT Sbjct: 184 QGSFRT 189 >gb|KFK27165.1| hypothetical protein AALP_AA8G343800 [Arabis alpina] Length = 76 Score = 62.0 bits (149), Expect = 6e-10 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -2 Query: 400 EKAISRPFAVAIRAARLYTAWLRYRFYVVVDLKGSIPAILECLF 269 EKAISRPFA+ R ARLYT WLRYR Y+V+ LK IPAI F Sbjct: 33 EKAISRPFAIVKRVARLYTGWLRYRSYIVIGLKSGIPAIQAYFF 76 >gb|EEF45989.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 311 DHYIEAIAKPSRIKASSPYSNSKRPTYS 394 DHYI AIAKPSRIKAS+PYSNSKRPTYS Sbjct: 32 DHYIGAIAKPSRIKASNPYSNSKRPTYS 59