BLASTX nr result
ID: Acanthopanax23_contig00018817
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00018817 (856 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017227759.1| PREDICTED: two-component response regulator ... 74 5e-11 gb|KZN10345.1| hypothetical protein DCAR_003001 [Daucus carota s... 70 1e-09 >ref|XP_017227759.1| PREDICTED: two-component response regulator ARR12 [Daucus carota subsp. sativus] Length = 614 Score = 73.9 bits (180), Expect = 5e-11 Identities = 47/115 (40%), Positives = 58/115 (50%), Gaps = 2/115 (1%) Frame = -2 Query: 855 CFKQTNPGILRDTGPSI-MHVGSDSHDVSSINLAPAQYPDAKIDILQCQAGSGSCGIEQN 679 CF+ T+P ILRD + +++GSD HD SS L P PD ID+LQCQ+ S + Sbjct: 510 CFRHTSPSILRDNSLLVPLNIGSDPHDASSFTLRPTHVPDGNIDLLQCQSASSN------ 563 Query: 678 INVTLQQGWDDSKQDA-SHQXXXXXXXXXXXLPHDVAXXXXXXXXXXXNQLWRQL 517 TL QGW DSKQDA HQ LP V+ N+ WRQL Sbjct: 564 ---TL-QGWGDSKQDAVPHQTNLISSSVNSWLPQGVSSSFDPSVMSSNNEHWRQL 614 >gb|KZN10345.1| hypothetical protein DCAR_003001 [Daucus carota subsp. sativus] Length = 647 Score = 69.7 bits (169), Expect = 1e-09 Identities = 37/76 (48%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = -2 Query: 855 CFKQTNPGILRDTGPSI-MHVGSDSHDVSSINLAPAQYPDAKIDILQCQAGSGSCGIEQN 679 CF+ T+P ILRD + +++GSD HD SS L P PD ID+LQCQ+ S + Sbjct: 504 CFRHTSPSILRDNSLLVPLNIGSDPHDASSFTLRPTHVPDGNIDLLQCQSASSN------ 557 Query: 678 INVTLQQGWDDSKQDA 631 TL QGW DSKQDA Sbjct: 558 ---TL-QGWGDSKQDA 569