BLASTX nr result
ID: Acanthopanax23_contig00017786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017786 (546 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN05669.1| hypothetical protein DCAR_006506 [Daucus carota s... 52 9e-06 >gb|KZN05669.1| hypothetical protein DCAR_006506 [Daucus carota subsp. sativus] Length = 83 Score = 52.0 bits (123), Expect = 9e-06 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (4%) Frame = +2 Query: 137 AGRSDGINKNAMKLTSPQEVITKMKVRRVLSTGGVDVQDYHGAEANPVHD---PGKGKTG 307 AGRSD +KL +V K K+R++LS V+V DY NP HD PGKGK G Sbjct: 20 AGRSDDGRTKYVKLCDSCDVAMKTKIRKILSV--VEVLDYRDPGPNPGHDPGGPGKGKPG 77 Query: 308 GRAANP 325 G+ NP Sbjct: 78 GKGINP 83