BLASTX nr result
ID: Acanthopanax23_contig00017489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017489 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274977.1| PREDICTED: NADPH-dependent pterin aldehyde r... 58 2e-07 ref|XP_017229263.1| PREDICTED: NADPH-dependent pterin aldehyde r... 57 9e-07 emb|CDO97648.1| unnamed protein product [Coffea canephora] 55 1e-06 emb|CAN82350.1| hypothetical protein VITISV_019435 [Vitis vinifera] 57 1e-06 gb|PHT41527.1| NADPH-dependent pterin aldehyde reductase [Capsic... 56 1e-06 ref|XP_006349286.1| PREDICTED: NADPH-dependent pterin aldehyde r... 56 1e-06 ref|XP_015064843.1| PREDICTED: NADPH-dependent pterin aldehyde r... 56 2e-06 ref|XP_004230419.1| PREDICTED: NADPH-dependent pterin aldehyde r... 56 2e-06 ref|XP_010314315.1| PREDICTED: NADPH-dependent pterin aldehyde r... 56 2e-06 gb|PIA55245.1| hypothetical protein AQUCO_00800163v1 [Aquilegia ... 55 2e-06 gb|PHU10262.1| NADPH-dependent pterin aldehyde reductase [Capsic... 55 2e-06 gb|PHT63676.1| NADPH-dependent pterin aldehyde reductase [Capsic... 55 2e-06 ref|XP_016538953.1| PREDICTED: NADPH-dependent pterin aldehyde r... 55 2e-06 ref|XP_002268804.1| PREDICTED: NADPH-dependent pterin aldehyde r... 55 3e-06 emb|CBI29642.3| unnamed protein product, partial [Vitis vinifera] 55 3e-06 ref|XP_019171681.1| PREDICTED: NADPH-dependent pterin aldehyde r... 55 3e-06 ref|XP_020111256.1| NADPH-dependent pterin aldehyde reductase [A... 54 6e-06 gb|KVH88683.1| Glucose/ribitol dehydrogenase [Cynara cardunculus... 54 6e-06 ref|XP_021998954.1| NADPH-dependent pterin aldehyde reductase [H... 54 8e-06 ref|XP_021678834.1| NADPH-dependent pterin aldehyde reductase-li... 54 8e-06 >ref|XP_010274977.1| PREDICTED: NADPH-dependent pterin aldehyde reductase isoform X2 [Nelumbo nucifera] Length = 244 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PEAWAPKAA MILNLTMADNGASL+V Sbjct: 213 ASLYQTPEAWAPKAATMILNLTMADNGASLSV 244 >ref|XP_017229263.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Daucus carota subsp. sativus] Length = 244 Score = 56.6 bits (135), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PEAWAPKAA MILNLT ADNGASLT+ Sbjct: 213 ASLYQQPEAWAPKAATMILNLTAADNGASLTI 244 >emb|CDO97648.1| unnamed protein product [Coffea canephora] Length = 170 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 AS Y PEAWAP+AA MILNL+MADNGASLTV Sbjct: 139 ASFYQTPEAWAPRAATMILNLSMADNGASLTV 170 >emb|CAN82350.1| hypothetical protein VITISV_019435 [Vitis vinifera] Length = 310 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 A+LY PEAWAPKAA+MILNLT ADNGASLTV Sbjct: 279 AALYQTPEAWAPKAASMILNLTAADNGASLTV 310 >gb|PHT41527.1| NADPH-dependent pterin aldehyde reductase [Capsicum baccatum] Length = 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 222 ASLYQTPESWAPKAANMILNLTMADNGASLSV 253 >ref|XP_006349286.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Solanum tuberosum] Length = 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 222 ASLYQTPESWAPKAANMILNLTMADNGASLSV 253 >ref|XP_015064843.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Solanum pennellii] Length = 313 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 282 ASLYQTPESWAPKAANMILNLTMADNGASLSV 313 >ref|XP_004230419.1| PREDICTED: NADPH-dependent pterin aldehyde reductase isoform X2 [Solanum lycopersicum] Length = 313 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 282 ASLYQTPESWAPKAANMILNLTMADNGASLSV 313 >ref|XP_010314315.1| PREDICTED: NADPH-dependent pterin aldehyde reductase isoform X1 [Solanum lycopersicum] Length = 315 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 284 ASLYQTPESWAPKAANMILNLTMADNGASLSV 315 >gb|PIA55245.1| hypothetical protein AQUCO_00800163v1 [Aquilegia coerulea] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 A+LY PEAWAPKAAAM+LNLT ADNG SLTV Sbjct: 222 ANLYQTPEAWAPKAAAMVLNLTAADNGQSLTV 253 >gb|PHU10262.1| NADPH-dependent pterin aldehyde reductase [Capsicum chinense] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE WAPKAA MILNLTMADNGASL+V Sbjct: 222 ASLYQTPELWAPKAANMILNLTMADNGASLSV 253 >gb|PHT63676.1| NADPH-dependent pterin aldehyde reductase [Capsicum annuum] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE WAPKAA MILNLTMADNGASL+V Sbjct: 222 ASLYQTPELWAPKAANMILNLTMADNGASLSV 253 >ref|XP_016538953.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Capsicum annuum] Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE WAPKAA MILNLTMADNGASL+V Sbjct: 222 ASLYQTPELWAPKAANMILNLTMADNGASLSV 253 >ref|XP_002268804.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Vitis vinifera] Length = 264 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 A+LY PE+WAPKAA+MILNLT ADNGASLTV Sbjct: 233 AALYQTPESWAPKAASMILNLTAADNGASLTV 264 >emb|CBI29642.3| unnamed protein product, partial [Vitis vinifera] Length = 307 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 A+LY PE+WAPKAA+MILNLT ADNGASLTV Sbjct: 276 AALYQTPESWAPKAASMILNLTAADNGASLTV 307 >ref|XP_019171681.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Ipomoea nil] Length = 256 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 ASLY PE+WAPKAA MILNLT+ADNG SLTV Sbjct: 225 ASLYQAPESWAPKAATMILNLTVADNGLSLTV 256 >ref|XP_020111256.1| NADPH-dependent pterin aldehyde reductase [Ananas comosus] Length = 246 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 A+LY PEAWAPKAA MILNLT DNGASLTV Sbjct: 215 AALYQTPEAWAPKAATMILNLTTEDNGASLTV 246 >gb|KVH88683.1| Glucose/ribitol dehydrogenase [Cynara cardunculus var. scolymus] Length = 254 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 +SLY PE+WAPKAA MILNLTMADNGASL+V Sbjct: 223 SSLYQPPESWAPKAADMILNLTMADNGASLSV 254 >ref|XP_021998954.1| NADPH-dependent pterin aldehyde reductase [Helianthus annuus] gb|OTG06163.1| putative NAD(P)-binding Rossmann-fold superfamily protein [Helianthus annuus] Length = 243 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 +SLY P+AWAPKAA MILNLTMADNG+SL+V Sbjct: 212 SSLYQAPDAWAPKAADMILNLTMADNGSSLSV 243 >ref|XP_021678834.1| NADPH-dependent pterin aldehyde reductase-like isoform X1 [Hevea brasiliensis] Length = 250 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 415 ASLYLLPEAWAPKAAAMILNLTMADNGASLTV 320 AS+Y P+AWAPKAA MILNLT ADNGASLTV Sbjct: 219 ASIYQEPDAWAPKAATMILNLTGADNGASLTV 250