BLASTX nr result
ID: Acanthopanax23_contig00017466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017466 (678 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017217061.1| PREDICTED: uncharacterized protein LOC108194... 52 9e-08 >ref|XP_017217061.1| PREDICTED: uncharacterized protein LOC108194616 [Daucus carota subsp. sativus] gb|KZM87033.1| hypothetical protein DCAR_024167 [Daucus carota subsp. sativus] Length = 162 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = +1 Query: 463 ISIEETSGFIRFVTKIENFDFSGAGNKVK----EIHPRVTKIVNRNG 591 + IE+T IRF+ +IE+FD SGA N V+ EIHP VTKIV RNG Sbjct: 51 VLIEDTDDAIRFIAEIEDFDLSGAQNNVRAHAVEIHPGVTKIVIRNG 97 Score = 33.1 bits (74), Expect(2) = 9e-08 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = +2 Query: 584 EMGELLLDQLKVDVWRFR 637 EMGELL+++L VDVWR+R Sbjct: 98 EMGELLVNELMVDVWRYR 115