BLASTX nr result
ID: Acanthopanax23_contig00017441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017441 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238194.1| ribosomal protein S7 [Glycine max] >gi|25562... 260 4e-86 ref|YP_009261526.1| ribosomal protein S7 (chloroplast) [Lirioden... 253 1e-83 ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] >gi|522208... 253 1e-83 ref|YP_009370066.1| ribosomal protein S7 (chloroplast) [Asparagu... 253 1e-83 ref|YP_740248.1| ribosomal protein S7 [Liriodendron tulipifera] ... 253 1e-83 ref|YP_009180153.1| ribosomal protein S7 (chloroplast) [Polygona... 253 1e-83 gb|AEX94177.1| ribosomal protein S7 (chloroplast) [Brodiaea cali... 253 1e-83 gb|AAS65721.1| ribosomal protein S7 (chloroplast) [Kingia austra... 253 1e-83 ref|YP_009059565.1| ribosomal protein S7 [Iris gatesii] >gi|6979... 253 1e-83 ref|YP_009365458.1| ribosomal protein S7 (plastid) [Illicium flo... 253 2e-83 gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta]... 253 2e-83 gb|AEX94160.1| ribosomal protein S7 (chloroplast) [Bowiea volubi... 253 2e-83 gb|AEX94156.1| ribosomal protein S7 (chloroplast) [Haworthia cym... 253 2e-83 gb|AEX94145.1| ribosomal protein S7 (chloroplast) [Tulbaghia vio... 253 2e-83 ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum... 252 3e-83 gb|AKR80664.1| ribosomal protein S7 (plastid) [Croomia japonica]... 252 3e-83 ref|YP_003434021.1| ribosomal protein S7 [Typha latifolia] >gi|2... 252 3e-83 ref|YP_004769759.1| ribosomal protein S7 [Magnolia kwangsiensis]... 252 3e-83 ref|YP_009409282.1| ribosomal protein S7 (chloroplast) [Aloe mac... 252 4e-83 gb|AFG25696.1| ribosomal protein S7, partial (plastid) [Iris vir... 252 4e-83 >ref|NP_001238194.1| ribosomal protein S7 [Glycine max] gb|ACU14175.1| unknown [Glycine max] Length = 173 Score = 260 bits (664), Expect = 4e-86 Identities = 138/159 (86%), Positives = 140/159 (88%), Gaps = 12/159 (7%) Frame = +1 Query: 58 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTET 237 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTET Sbjct: 15 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTET 74 Query: 238 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXX 381 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVP+EIGSTQGK Sbjct: 75 NPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNM 134 Query: 382 AFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 AFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 135 AFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 173 >ref|YP_009261526.1| ribosomal protein S7 (chloroplast) [Liriodendron chinense] ref|YP_009261539.1| ribosomal protein S7 (chloroplast) [Liriodendron chinense] gb|ANN44776.1| ribosomal protein S7 (chloroplast) [Liriodendron chinense] gb|ANN44789.1| ribosomal protein S7 (chloroplast) [Liriodendron chinense] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRSGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_087012.1| ribosomal protein S7 [Panax ginseng] ref|YP_087025.1| ribosomal protein S7 [Panax ginseng] ref|YP_740163.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_740176.1| ribosomal protein S7 (chloroplast) [Daucus carota] ref|YP_004222692.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004222705.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] ref|YP_004733889.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004733902.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] ref|YP_004935599.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_004935612.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] ref|YP_008815077.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815090.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] ref|YP_008815164.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008815177.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] ref|YP_008814903.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008814916.1| ribosomal protein S7 (chloroplast) [Aralia undulata] ref|YP_008815251.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_008815264.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] ref|YP_009121220.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009121233.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] ref|YP_009122772.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009122785.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] ref|YP_009155258.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155271.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] ref|YP_009155473.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009155487.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] ref|YP_009159584.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009159598.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] ref|YP_009161726.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009161739.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] ref|YP_009186298.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009186313.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] ref|YP_009191899.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191913.1| ribosomal protein S7 (chloroplast) [Panax japonicus] ref|YP_009191986.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009192000.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] ref|YP_009232790.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232806.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] ref|YP_009232875.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232891.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] ref|YP_009232960.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009232976.1| ribosomal protein S7 (chloroplast) [Angelica gigas] ref|YP_009233044.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009233060.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] ref|YP_009235925.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009235939.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] ref|YP_009236010.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009236023.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] ref|YP_009240841.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009240854.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] ref|YP_009241112.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009241098.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] ref|YP_009266564.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009266578.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] ref|YP_009306821.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009306834.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] ref|YP_009330735.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009330748.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] ref|YP_009331749.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338302.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338315.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] ref|YP_009338386.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338400.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] ref|YP_009338469.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009338482.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009363624.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363640.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] ref|YP_009363723.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363739.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] ref|YP_009363539.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009363555.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] ref|YP_009367049.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009367062.1| ribosomal protein S7 (plastid) [Actaea racemosa] ref|YP_009379660.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379674.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] ref|YP_009379572.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009379586.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] ref|YP_009387618.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387605.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] ref|YP_009387690.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387703.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] ref|YP_009387775.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387788.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] ref|YP_009387860.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009387873.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] ref|YP_009434292.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] ref|YP_009434305.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] sp|Q68RU7.1|RR7_PANGI RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q0G9Q3.1|RR7_DAUCA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAT98555.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AAT98570.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|ABI32469.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABI32484.1| ribosomal protein S7 (chloroplast) [Daucus carota] gb|ABU85171.1| ribosomal protein S7, partial (chloroplast) [Anethum graveolens] gb|ADD13684.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD13698.1| ribosomal protein S7 (chloroplast) [Anthriscus cerefolium] gb|ADD29890.1| ribosomal protein S7 (chloroplast) [Aucuba japonica] gb|ADK89824.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89838.1| ribosomal protein S7 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|ADK89997.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADK90011.1| ribosomal protein S7 (chloroplast) [Petroselinum crispum] gb|ADM92747.1| ribosomal protein S7, partial (chloroplast) [Davidia involucrata] gb|AEK71711.1| ribosomal protein S7 (plastid) [Aucuba japonica] gb|AEO92665.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AEO92678.1| ribosomal protein S7 (chloroplast) [Eleutherococcus senticosus] gb|AGG39002.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39017.1| ribosomal protein S7 (chloroplast) [Aralia undulata] gb|AGG39176.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39191.1| ribosomal protein S7 (chloroplast) [Metapanax delavayi] gb|AGG39263.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39278.1| ribosomal protein S7 (chloroplast) [Schefflera delavayi] gb|AGG39350.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGG39365.1| ribosomal protein S7 (chloroplast) [Kalopanax septemlobus] gb|AGM15028.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15029.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15114.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15115.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15200.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGM15201.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31960.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AGW31961.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AHJ81010.1| ribosomal protein S7 (mitochondrion) [Panax ginseng] gb|AIA24374.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIA24387.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AIU99067.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIU99080.1| ribosomal protein S7 (plastid) [Pastinaca pimpinellifolia] gb|AIX97934.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX97948.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98019.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98033.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98104.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98118.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98189.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98203.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98274.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98288.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98359.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98373.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98444.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98458.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98529.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98543.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98615.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AIX98629.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99533.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99547.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|AJC99618.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99632.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99703.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJC99717.1| ribosomal protein S7 (chloroplast) [Panax ginseng] gb|AJK29888.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJK29889.1| ribosomal protein S7 (chloroplast) [Dendropanax dentiger] gb|AJO25247.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AJO25248.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AKB99118.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99132.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKB99205.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99219.1| ribosomal protein S7 (chloroplast) [Panax japonicus] gb|AKB99292.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99306.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99379.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKB99393.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AKG26647.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKG26660.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKQ20774.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKQ20788.1| ribosomal protein S7 (chloroplast) [Dendropanax morbifer] gb|AKS11000.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKS11014.1| ribosomal protein S7 (chloroplast) [Fatsia japonica] gb|AKU70823.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKU70837.1| ribosomal protein S7 (chloroplast) [Panax notoginseng] gb|AKZ24089.1| ribosomal protein S7 (plastid) [Cicuta maculata] gb|AKZ24090.1| ribosomal protein S7 (plastid) [Conium maculatum] gb|AKZ24091.1| ribosomal protein S7 (plastid) [Zizia aurea] gb|AKZ29807.1| ribosomal protein S7 (chloroplast) [Panax quinquefolius] gb|ALN96875.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALN96876.1| ribosomal protein S7 (chloroplast) [Angelica decursiva] gb|ALO71652.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|ALO71653.1| ribosomal protein S7 (chloroplast) [Ostericum grosseserratum] gb|AMA97862.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97863.1| ribosomal protein S7 (chloroplast) [Angelica acutiloba] gb|AMA97948.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA97949.1| ribosomal protein S7 (chloroplast) [Angelica dahurica] gb|AMA98033.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98034.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AMA98120.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMA98121.1| ribosomal protein S7 (chloroplast) [Ligusticum tenuissimum] gb|AMD83961.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD83976.1| ribosomal protein S7 (chloroplast) [Foeniculum vulgare] gb|AMD84046.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMD84060.1| ribosomal protein S7 (chloroplast) [Anethum graveolens] gb|AMK46209.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMK46222.1| ribosomal protein S7 (chloroplast) [Schefflera heptaphylla] gb|AMR97494.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|AMR97508.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|KZM81269.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|KZM81282.1| ribosomal protein S7 (plastid) [Daucus carota subsp. sativus] gb|ANK36397.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36410.1| ribosomal protein S7 (chloroplast) [Pleurospermum camtschaticum] gb|ANK36481.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36495.1| ribosomal protein S7 (chloroplast) [Peucedanum insolens] gb|ANK36564.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36577.1| ribosomal protein S7 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK78376.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78390.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ANK78462.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANK78476.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ANS71815.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71829.1| ribosomal protein S7 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71902.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71916.1| ribosomal protein S7 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71989.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72003.1| ribosomal protein S7 (chloroplast) [Aralia elata] gb|ANS72075.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72091.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|ANS72158.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|ANS72174.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOC32763.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOC32764.1| ribosomal protein S7 (chloroplast) [Chuanminshen violaceum] gb|AOQ76964.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOQ76966.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AOT84427.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84443.1| ribosomal protein S7 (chloroplast) [Ledebouriella seseloides] gb|AOT84512.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84528.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84611.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84627.1| ribosomal protein S7 (chloroplast) [Peucedanum japonicum] gb|AOT84710.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|AOT84726.1| ribosomal protein S7 (chloroplast) [Glehnia littoralis] gb|APB93649.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93662.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93734.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93747.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB93819.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93832.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB93904.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93917.1| ribosomal protein S7 (plastid) [Daucus carota subsp. capillifolius] gb|APB93989.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94002.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94074.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94087.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94159.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94172.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94244.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94257.1| ribosomal protein S7 (plastid) [Daucus carota subsp. gummifer] gb|APB94329.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94342.1| ribosomal protein S7 (plastid) [Daucus carota subsp. carota] gb|APB94414.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94427.1| ribosomal protein S7 (plastid) [Daucus carota subsp. maximus] gb|APB94499.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94512.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94584.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94597.1| ribosomal protein S7 (plastid) [Daucus syrticus] gb|APB94669.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94682.1| ribosomal protein S7 (plastid) [Daucus rouyi] gb|APB94754.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94767.1| ribosomal protein S7 (plastid) [Daucus pumilus] gb|APB94839.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94852.1| ribosomal protein S7 (plastid) [Daucus aureus] gb|APB94924.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB94937.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95009.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95022.1| ribosomal protein S7 (plastid) [Daucus muricatus] gb|APB95094.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95107.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95179.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95192.1| ribosomal protein S7 (plastid) [Daucus crinitus] gb|APB95264.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95277.1| ribosomal protein S7 (plastid) [Daucus tenuisectus] gb|APB95349.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95362.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95434.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95447.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95519.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95532.1| ribosomal protein S7 (plastid) [Daucus littoralis] gb|APB95604.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95617.1| ribosomal protein S7 (plastid) [Daucus glochidiatus] gb|APB95689.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95702.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95774.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95787.1| ribosomal protein S7 (plastid) [Daucus guttatus] gb|APB95859.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95872.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95944.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB95957.1| ribosomal protein S7 (plastid) [Daucus setulosus] gb|APB96029.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96042.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96114.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96127.1| ribosomal protein S7 (plastid) [Daucus pusillus] gb|APB96199.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96212.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96283.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96296.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96368.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96381.1| ribosomal protein S7 (plastid) [Daucus conchitae] gb|APB96453.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96466.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96538.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96551.1| ribosomal protein S7 (plastid) [Daucus involucratus] gb|APB96623.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96636.1| ribosomal protein S7 (plastid) [Caucalis platycarpos] gb|APB96708.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APB96721.1| ribosomal protein S7 (plastid) [Oenanthe virgata] gb|APD79337.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APD79350.1| 30S ribosomal protein S7 (chloroplast) [Viburnum utile] gb|APH07318.1| ribosomal protein S7 (chloroplast) [Arracacia xanthorrhiza] gb|AQU64682.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64683.1| 30S ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AQU64769.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64770.1| 30S ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AQU64854.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AQU64855.1| 30S ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|ARJ61717.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARJ61718.1| ribosomal protein S7 (plastid) [Eleutherococcus senticosus] gb|ARQ81805.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81819.1| ribosomal protein S7 (chloroplast) [Hydrangea petiolaris] gb|ARQ81893.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81907.1| ribosomal protein S7 (chloroplast) [Hydrangea hydrangeoides] gb|ART32505.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32506.1| ribosomal protein S7 (chloroplast) [Hansenia weberbaueriana] gb|ART32590.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32591.1| ribosomal protein S7 (chloroplast) [Hansenia forbesii] gb|ART32675.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32676.1| ribosomal protein S7 (chloroplast) [Hansenia oviformis] gb|ART32760.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ART32761.1| ribosomal protein S7 (chloroplast) [Hansenia forrestii] gb|ARX79284.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ARX79297.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATI20909.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATI20923.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26070.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26071.1| ribosomal protein S7 (chloroplast) [Panax japonicus var. bipinnatifidus] gb|ATJ26174.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26188.1| ribosomal protein S7 (chloroplast) [Panax sp. VM-2017] gb|ATJ26242.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26243.1| ribosomal protein S7 (chloroplast) [Panax stipuleanatus] gb|ATJ26327.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATJ26328.1| ribosomal protein S7 (chloroplast) [Panax vietnamensis] gb|ATL63061.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATL63077.1| ribosomal protein S7 (chloroplast) [Angelica nitida] gb|ATN40524.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|ATN40525.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF33230.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33231.1| ribosomal protein S7 (chloroplast) [Diplopanax stachyanthus] gb|AUF33400.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33401.1| ribosomal protein S7 (chloroplast) [Deutzia crassifolia] gb|AUF33570.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33571.1| ribosomal protein S7 (chloroplast) [Nyssa wenshanensis] gb|AUF33654.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33655.1| ribosomal protein S7 (chloroplast) [Alangium chinense] gb|AUF33909.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33910.1| ribosomal protein S7 (chloroplast) [Curtisia dentata] gb|AUF33995.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF33996.1| ribosomal protein S7 (chloroplast) [Nyssa sinensis] gb|AUF34079.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34080.1| ribosomal protein S7 (chloroplast) [Mastixia caudatilimba] gb|AUF34165.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34166.1| ribosomal protein S7 (chloroplast) [Davidia involucrata] gb|AUF34249.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34250.1| ribosomal protein S7 (chloroplast) [Alangium alpinum] gb|AUF34420.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AUF34421.1| ribosomal protein S7 (chloroplast) [Camptotheca acuminata] gb|AVK80245.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] gb|AVK80246.1| ribosomal protein S7 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009370066.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] ref|YP_009370078.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] ref|YP_009431178.1| ribosomal protein S7 (chloroplast) [Asparagus schoberioides] ref|YP_009431191.1| ribosomal protein S7 (chloroplast) [Asparagus schoberioides] sp|Q67IC5.1|RR7_ASPOF RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAN32069.1| ribosomal protein S7 (chloroplast) [Xeronema callistemon] gb|AAN32078.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] gb|AEX94151.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] gb|AEX94152.1| ribosomal protein S7 (chloroplast) [Asparagus asparagoides] gb|AEX94153.1| ribosomal protein S7 (chloroplast) [Hemiphylacus alatostylus] gb|AEX94183.1| ribosomal protein S7 (chloroplast) [Xeronema callistemon] gb|AFG25680.1| ribosomal protein S7, partial (plastid) [Asparagus officinalis] gb|ARO91472.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] gb|ARO91484.1| ribosomal protein S7 (chloroplast) [Asparagus officinalis] gb|ASW26614.1| ribosomal protein S7 (chloroplast) [Asparagus schoberioides] gb|ASW26628.1| ribosomal protein S7 (chloroplast) [Asparagus schoberioides] emb|CUS18758.1| ribosomal protein S7 (plastid) [Asparagus officinalis] emb|CUS18771.1| ribosomal protein S7 (plastid) [Asparagus officinalis] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLVASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_740248.1| ribosomal protein S7 [Liriodendron tulipifera] ref|YP_740261.1| ribosomal protein S7 [Liriodendron tulipifera] ref|YP_740611.1| ribosomal protein S7 [Platanus occidentalis] ref|YP_740624.1| ribosomal protein S7 [Platanus occidentalis] ref|YP_784433.1| ribosomal protein S7 [Drimys granadensis] ref|YP_784446.1| ribosomal protein S7 [Drimys granadensis] ref|YP_001294316.1| ribosomal protein S7 [Illicium oligandrum] ref|YP_001294330.1| ribosomal protein S7 [Illicium oligandrum] ref|YP_001294230.1| ribosomal protein S7 [Buxus microphylla] ref|YP_001294244.1| ribosomal protein S7 [Buxus microphylla] ref|YP_007476093.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] ref|YP_007476107.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] ref|YP_008963738.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] ref|YP_008963751.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] ref|YP_009027932.1| ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] ref|YP_009027945.1| ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] ref|YP_009028015.1| ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] ref|YP_009028028.1| ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] ref|YP_009028264.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] ref|YP_009028277.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] ref|YP_009028347.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] ref|YP_009028360.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] ref|YP_009045611.1| ribosomal protein S7 (chloroplast) [Cypripedium macranthos] ref|YP_009045624.1| ribosomal protein S7 (chloroplast) [Cypripedium macranthos] ref|YP_009028430.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] ref|YP_009028443.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] ref|YP_009092350.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] ref|YP_009092364.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] ref|YP_009114493.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] ref|YP_009114505.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] ref|YP_009183244.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ref|YP_009183256.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ref|YP_009228810.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ref|YP_009228822.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ref|YP_009231294.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] ref|YP_009231307.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] ref|YP_009234770.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] ref|YP_009234783.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] ref|YP_009236417.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] ref|YP_009236405.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] ref|YP_009262993.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ref|YP_009263006.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ref|YP_009263159.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] ref|YP_009263172.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] ref|YP_009263906.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ref|YP_009263919.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ref|YP_009263989.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ref|YP_009264002.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ref|YP_009264072.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ref|YP_009264085.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ref|YP_009264155.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ref|YP_009264168.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ref|YP_009264238.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] ref|YP_009264251.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] ref|YP_009264321.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] ref|YP_009264334.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] ref|YP_009264404.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ref|YP_009264417.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ref|YP_009264487.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] ref|YP_009264500.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] ref|YP_009264570.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ref|YP_009264583.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ref|YP_009264653.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] ref|YP_009264666.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] ref|YP_009264817.1| ribosomal protein S7 (chloroplast) [Licania canescens] ref|YP_009264830.1| ribosomal protein S7 (chloroplast) [Licania canescens] ref|YP_009264900.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] ref|YP_009264913.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] ref|YP_009264983.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] ref|YP_009264996.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] ref|YP_009265066.1| ribosomal protein S7 (chloroplast) [Licania majuscula] ref|YP_009265079.1| ribosomal protein S7 (chloroplast) [Licania majuscula] ref|YP_009265149.1| ribosomal protein S7 (chloroplast) [Licania membranacea] ref|YP_009265162.1| ribosomal protein S7 (chloroplast) [Licania membranacea] ref|YP_009265232.1| ribosomal protein S7 (chloroplast) [Licania michauxii] ref|YP_009265245.1| ribosomal protein S7 (chloroplast) [Licania michauxii] ref|YP_009265315.1| ribosomal protein S7 (chloroplast) [Licania micrantha] ref|YP_009265328.1| ribosomal protein S7 (chloroplast) [Licania micrantha] ref|YP_009265398.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] ref|YP_009265411.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] ref|YP_009265481.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] ref|YP_009265494.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] ref|YP_009265564.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] ref|YP_009265577.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] ref|YP_009265647.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] ref|YP_009265660.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] ref|YP_009265730.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ref|YP_009265743.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ref|YP_009265813.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] ref|YP_009265826.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] ref|YP_009265896.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] ref|YP_009265909.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] ref|YP_009262570.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] ref|YP_009262583.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] ref|YP_009333070.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ref|YP_009333082.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ref|YP_009334450.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] ref|YP_009334463.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] ref|YP_009334536.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] ref|YP_009334549.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] ref|YP_009334621.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] ref|YP_009334634.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] ref|YP_009334705.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] ref|YP_009334718.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] ref|YP_009334789.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] ref|YP_009334802.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] ref|YP_009334873.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] ref|YP_009334886.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] ref|YP_009334957.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] ref|YP_009334970.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] ref|YP_009335040.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] ref|YP_009335053.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] ref|YP_009335125.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] ref|YP_009335138.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] ref|YP_009335208.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] ref|YP_009335221.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] ref|YP_009335378.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] ref|YP_009335391.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] ref|YP_009335464.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] ref|YP_009335477.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] ref|YP_009335549.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] ref|YP_009335562.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] ref|YP_009341932.1| ribosomal protein S7 (chloroplast) [Aletris spicata] ref|YP_009341919.1| ribosomal protein S7 (chloroplast) [Aletris spicata] ref|YP_009342016.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] ref|YP_009342003.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] ref|YP_009366980.1| ribosomal protein S7 (plastid) [Illicium anisatum] ref|YP_009365801.1| ribosomal protein S7 (plastid) [Illicium verum] ref|YP_009366654.1| ribosomal protein S7 (plastid) [Illicium henryi] ref|YP_009414689.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] ref|YP_009414704.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] ref|YP_009420117.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] ref|YP_009420132.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] ref|YP_009431092.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] ref|YP_009431105.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] ref|YP_009431264.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] ref|YP_009431277.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] ref|YP_009432348.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] ref|YP_009432361.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] ref|YP_009432434.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] ref|YP_009432447.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] ref|YP_009432519.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] ref|YP_009432532.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] ref|YP_009432699.1| ribosomal protein S7 (chloroplast) [Hosta minor] ref|YP_009432686.1| ribosomal protein S7 (chloroplast) [Hosta minor] ref|YP_009432771.1| ribosomal protein S7 (chloroplast) [Milla biflora] ref|YP_009432784.1| ribosomal protein S7 (chloroplast) [Milla biflora] ref|YP_009434724.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] ref|YP_009434737.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] ref|YP_009445478.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] ref|YP_009445492.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] ref|YP_009458357.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] ref|YP_009458345.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] ref|YP_009471675.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] ref|YP_009471688.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] sp|Q67IB6.1|RR7_MAIRA RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IE0.1|RR7_SISMO RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q6EM68.1|RR7_PLAOC RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69663.1|RR7_CERJA RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69664.1|RR7_DRIWI RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69665.1|RR7_ILLPA RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69666.1|RR7_LIRTU RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IB0.1|RR7_LEOCS RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IE3.1|RR7_PHOTN RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q06GT7.1|RR7_DRIGR RecName: Full=30S ribosomal protein S7, chloroplastic sp|A6MM82.1|RR7_BUXMI RecName: Full=30S ribosomal protein S7, chloroplastic sp|A6MMZ0.1|RR7_ILLOL RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAG26107.1| ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] gb|AAG26113.1| ribosomal protein S7 (chloroplast) [Drimys winteri] gb|AAG26119.1| ribosomal protein S7 (chloroplast) [Illicium parviflorum] gb|AAG26125.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|AAQ14201.1| ribosomal protein S7 (chloroplast) [Austrobaileya scandens] gb|AAQ64573.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|AAN31991.1| ribosomal protein S7 (chloroplast) [Dasypogon hookeri] gb|AAN32022.1| ribosomal protein S7 (chloroplast) [Alania cunninghamii] gb|AAN32025.1| ribosomal protein S7 (chloroplast) [Asphodelus albus] gb|AAN32028.1| ribosomal protein S7 (chloroplast) [Astelia alpina] gb|AAN32040.1| ribosomal protein S7 (chloroplast) [Cyanastrum cordifolium] gb|AAN32045.1| ribosomal protein S7 (chloroplast) [Hemerocallis littorea] gb|AAN32060.1| ribosomal protein S7 (chloroplast) [Phormium tenax] gb|AAN32063.1| ribosomal protein S7 (chloroplast) [Sisyrinchium montanum] gb|AAN32066.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea resinosa] gb|AAN32075.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|AAN32087.1| ribosomal protein S7 (chloroplast) [Maianthemum racemosum] gb|AAN32090.1| ribosomal protein S7 (chloroplast) [Muilla maritima] gb|AAN32093.1| ribosomal protein S7 (chloroplast) [Leopoldia comosa] gb|AAN32096.1| ribosomal protein S7 (chloroplast) [Narcissus elegans] gb|ABH88343.1| ribosomal protein S7 (chloroplast) [Drimys granadensis] gb|ABH88358.1| ribosomal protein S7 (chloroplast) [Drimys granadensis] gb|ABI32555.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|ABI32569.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|ABI49825.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|ABI49838.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|ABQ14818.1| ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] gb|ABQ14826.1| ribosomal protein S7 (chloroplast) [Daphniphyllum sp. 205-82] gb|ABQ14834.1| ribosomal protein S7 (chloroplast) [Hamamelis japonica] gb|ABQ14886.1| ribosomal protein S7 (chloroplast) [Paeonia brownii] gb|ABQ45294.1| ribosomal protein S7 (chloroplast) [Buxus microphylla] gb|ABQ45310.1| ribosomal protein S7 (chloroplast) [Buxus microphylla] gb|ABQ52564.1| ribosomal protein S7 (chloroplast) [Illicium oligandrum] gb|ABQ52580.1| ribosomal protein S7 (chloroplast) [Illicium oligandrum] gb|ADD29908.1| ribosomal protein S7 (chloroplast) [Liquidambar styraciflua] gb|AEK71760.1| ribosomal protein S7 (plastid) [Liquidambar styraciflua] gb|AEK71822.1| ribosomal protein S7 (plastid) [Hedyosmum mexicanum] gb|AEK78132.1| ribosomal protein S7 (plastid) [Tasmannia lanceolata] gb|AEX94136.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|AEX94137.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|AEX94139.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|AEX94146.1| ribosomal protein S7 (chloroplast) [Amaryllis belladonna] gb|AEX94147.1| ribosomal protein S7 (chloroplast) [Crinum asiaticum] gb|AEX94149.1| ribosomal protein S7 (chloroplast) [Scadoxus cinnabarinus] gb|AEX94150.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|AEX94155.1| ribosomal protein S7 (chloroplast) [Asphodeline damascena] gb|AEX94157.1| ribosomal protein S7 (chloroplast) [Kniphofia linearifolia] gb|AEX94159.1| ribosomal protein S7 (chloroplast) [Phormium tenax] gb|AEX94161.1| ribosomal protein S7 (chloroplast) [Drimia altissima] gb|AEX94162.1| ribosomal protein S7 (chloroplast) [Ledebouria cordifolia] gb|AEX94163.1| ribosomal protein S7 (chloroplast) [Ornithogalum tenuifolium] gb|AEX94164.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|AEX94168.1| ribosomal protein S7 (chloroplast) [Beaucarnea hookeri] gb|AEX94169.1| ribosomal protein S7 (chloroplast) [Dasylirion wheeleri] gb|AEX94170.1| ribosomal protein S7 (chloroplast) [Eriospermum cervicorne] gb|AEX94171.1| ribosomal protein S7 (chloroplast) [Liriope spicata] gb|AEX94172.1| ribosomal protein S7 (chloroplast) [Ophiopogon japonicus] gb|AEX94173.1| ribosomal protein S7 (chloroplast) [Ruscus aculeatus] gb|AEX94174.1| ribosomal protein S7 (chloroplast) [Sansevieria trifasciata] gb|AEX94175.1| ribosomal protein S7 (chloroplast) [Maianthemum stellatum] gb|AEX94176.1| ribosomal protein S7 (chloroplast) [Androstephium coeruleum] gb|AEX94181.1| ribosomal protein S7 (chloroplast) [Triteleia hyacinthina] gb|AEX94182.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|AFG25678.1| ribosomal protein S7 (plastid) [Albuca kirkii] gb|AFG25688.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AFG25694.1| ribosomal protein S7, partial (plastid) [Hesperaloe parviflora] gb|AFG25695.1| ribosomal protein S7, partial (plastid) [Hosta ventricosa] gb|AFG25702.1| ribosomal protein S7, partial (plastid) [Neoastelia spectabilis] gb|AFG25704.1| ribosomal protein S7, partial (plastid) [Nolina atopocarpa] gb|AFG25706.1| ribosomal protein S7, partial (plastid) [Phormium tenax] gb|AGE93157.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AGE93173.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AGL13477.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] gb|AGL13490.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] gb|AHB38205.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] gb|AHB38221.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] gb|AHI16794.1| ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|AHI16807.1| ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|AHV83399.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] gb|AHV83409.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] gb|AHX80652.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|AHX80653.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|AHX80735.1| ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] gb|AHX80736.1| ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] gb|AHX80984.1| ribosomal protein S7 (chloroplast) [Licania alba] gb|AHX80985.1| ribosomal protein S7 (chloroplast) [Licania alba] gb|AHX81067.1| ribosomal protein S7 (chloroplast) [Licania sprucei] gb|AHX81068.1| ribosomal protein S7 (chloroplast) [Licania sprucei] gb|AHX81150.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] gb|AHX81151.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] gb|AKR80939.1| ribosomal protein S7 (plastid) [Lophiola aurea] gb|ALM87750.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] gb|ALM87751.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] gb|ALO71310.1| ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] gb|ALO71324.1| ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] gb|ALS19972.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] gb|ALS19973.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] gb|ALS20235.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] gb|ALS20236.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] gb|ALV25527.1| ribosomal protein S7 (chloroplast) [Aletris spicata] gb|ALV25528.1| ribosomal protein S7 (chloroplast) [Aletris spicata] gb|ALV25611.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] gb|ALV25612.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] gb|ALV89972.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] gb|ALV89985.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] gb|AMD08487.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] gb|AMD08500.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] gb|AMF84106.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] gb|AMF84107.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] gb|ANI87215.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] gb|ANI87216.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] gb|ANJ17111.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] gb|ANJ17112.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] gb|ANJ17276.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] gb|ANJ17277.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] gb|ANJ18107.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] gb|ANJ18108.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] gb|ANJ18190.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] gb|ANJ18191.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] gb|ANJ18273.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] gb|ANJ18274.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] gb|ANJ18356.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] gb|ANJ18357.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] gb|ANJ18439.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] gb|ANJ18440.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] gb|ANJ18522.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] gb|ANJ18523.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] gb|ANJ18605.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] gb|ANJ18606.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] gb|ANJ18688.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|ANJ18689.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|ANJ18771.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] gb|ANJ18772.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] gb|ANJ18854.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] gb|ANJ18855.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] gb|ANJ18937.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] gb|ANJ18938.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] gb|ANJ19101.1| ribosomal protein S7 (chloroplast) [Licania canescens] gb|ANJ19102.1| ribosomal protein S7 (chloroplast) [Licania canescens] gb|ANJ19184.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] gb|ANJ19185.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] gb|ANJ19267.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] gb|ANJ19268.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] gb|ANJ19350.1| ribosomal protein S7 (chloroplast) [Licania majuscula] gb|ANJ19351.1| ribosomal protein S7 (chloroplast) [Licania majuscula] gb|ANJ19433.1| ribosomal protein S7 (chloroplast) [Licania membranacea] gb|ANJ19434.1| ribosomal protein S7 (chloroplast) [Licania membranacea] gb|ANJ19516.1| ribosomal protein S7 (chloroplast) [Licania michauxii] gb|ANJ19517.1| ribosomal protein S7 (chloroplast) [Licania michauxii] gb|ANJ19618.1| ribosomal protein S7 (chloroplast) [Licania micrantha] gb|ANJ19633.1| ribosomal protein S7 (chloroplast) [Licania micrantha] gb|ANJ19701.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] gb|ANJ19716.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] gb|ANJ19784.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] gb|ANJ19799.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] gb|ANJ19867.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] gb|ANJ19882.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] gb|ANJ19950.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] gb|ANJ19965.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] gb|ANJ20014.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] gb|ANJ20015.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] gb|ANJ20097.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] gb|ANJ20098.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] gb|ANJ20180.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] gb|ANJ20181.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] gb|APO11260.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] gb|APO11273.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] gb|APO11346.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|APO11359.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|APO11430.1| ribosomal protein S7 (chloroplast) [Behnia reticulata] gb|APO11443.1| ribosomal protein S7 (chloroplast) [Behnia reticulata] gb|APO11514.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] gb|APO11527.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] gb|APO11598.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|APO11611.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|APO11682.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] gb|APO11695.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] gb|APO11931.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] gb|APO11944.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] gb|APO12015.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] gb|APO12028.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] gb|APO12098.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] gb|APO12111.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] gb|APO12183.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] gb|APO12196.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] gb|APO12266.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|APO12279.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|APO12436.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] gb|APO12449.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] gb|APO12522.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|APO12535.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|APO12693.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] gb|APO12706.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] gb|ARJ61286.1| ribosomal protein S7 (plastid) [Illicium verum] gb|ARJ62478.1| ribosomal protein S7 (plastid) [Illicium henryi] gb|ARJ63232.1| ribosomal protein S7 (plastid) [Illicium anisatum] gb|ASO75455.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] gb|ASO75456.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] gb|ASO75541.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] gb|ASO75542.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] gb|ASW26527.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|ASW26542.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|ASW26700.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] gb|ASW26714.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] gb|ATB18603.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] gb|ATB18617.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] gb|ATB18689.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|ATB18703.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|ATB18774.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] gb|ATB18788.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] gb|ATB18891.1| ribosomal protein S7 (chloroplast) [Hosta minor] gb|ATB18939.1| ribosomal protein S7 (chloroplast) [Hosta minor] gb|ATB19026.1| ribosomal protein S7 (chloroplast) [Milla biflora] gb|ATB19040.1| ribosomal protein S7 (chloroplast) [Milla biflora] gb|ATG24524.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] gb|ATG24537.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] gb|ATV96213.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] gb|ATV96227.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] gb|AUR26714.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] gb|AUR26727.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] gb|AVI15343.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15356.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15429.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15442.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009180153.1| ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] ref|YP_009180165.1| ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] gb|ALL96508.1| ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] gb|ALL96509.1| ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKCPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AEX94177.1| ribosomal protein S7 (chloroplast) [Brodiaea californica] gb|AEX94179.1| ribosomal protein S7 (chloroplast) [Dichelostemma congestum] gb|AEX94180.1| ribosomal protein S7 (chloroplast) [Dichelostemma ida-maia] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGQNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AAS65721.1| ribosomal protein S7 (chloroplast) [Kingia australis] gb|AFG25698.1| ribosomal protein S7, partial (plastid) [Kingia australis] gb|AFM83339.1| ribosomal protein S7 (chloroplast) [Kingia australis] gb|AFM83353.1| ribosomal protein S7 (chloroplast) [Kingia australis] gb|AGE93243.1| ribosomal protein S7 (plastid) [Calectasia narragara] gb|AGE93258.1| ribosomal protein S7 (plastid) [Calectasia narragara] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGTSRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009059565.1| ribosomal protein S7 [Iris gatesii] ref|YP_009059578.1| ribosomal protein S7 [Iris gatesii] ref|YP_009229119.1| ribosomal protein S7 (chloroplast) [Iris sanguinea] ref|YP_009229133.1| ribosomal protein S7 (chloroplast) [Iris sanguinea] gb|AAN32048.1| ribosomal protein S7 (chloroplast) [Iris missouriensis] gb|AEX94165.1| ribosomal protein S7 (chloroplast) [Iris tenax] gb|AIN79039.1| ribosomal protein S7 (plastid) [Iris gatesii] gb|AIN79040.1| ribosomal protein S7 (plastid) [Iris gatesii] gb|ALS46383.1| ribosomal protein S7 (chloroplast) [Iris sanguinea] gb|ALS46398.1| ribosomal protein S7 (chloroplast) [Iris sanguinea] Length = 155 Score = 253 bits (646), Expect = 1e-83 Identities = 136/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009365458.1| ribosomal protein S7 (plastid) [Illicium floridanum] gb|ARJ60954.1| ribosomal protein S7 (plastid) [Illicium floridanum] Length = 155 Score = 253 bits (645), Expect = 2e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRG+TPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGITPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|ADD29893.1| ribosomal protein S7 (chloroplast) [Ilex cornuta] gb|AEK71617.1| ribosomal protein S7 (plastid) [Ilex cornuta] gb|AJW59668.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|AJW59681.1| ribosomal protein S7 (chloroplast) [Ilex paraguariensis] gb|ANS80773.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80794.1| 30S ribosomal protein S7 (chloroplast) [Ilex latifolia] gb|ANS80868.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80889.1| 30S ribosomal protein S7 (chloroplast) [Ilex szechwanensis] gb|ANS80963.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS80984.1| 30S ribosomal protein S7 (chloroplast) [Ilex pubescens] gb|ANS81058.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81079.1| 30S ribosomal protein S7 (chloroplast) [Ilex polyneura] gb|ANS81153.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81174.1| 30S ribosomal protein S7 (chloroplast) [Ilex sp. XY-2016] gb|ANS81248.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81269.1| 30S ribosomal protein S7 (chloroplast) [Ilex delavayi] gb|ANS81343.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] gb|ANS81364.1| 30S ribosomal protein S7 (chloroplast) [Ilex wilsonii] Length = 155 Score = 253 bits (645), Expect = 2e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIVYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AEX94160.1| ribosomal protein S7 (chloroplast) [Bowiea volubilis] Length = 155 Score = 253 bits (645), Expect = 2e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSEL+DAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELIDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AEX94156.1| ribosomal protein S7 (chloroplast) [Haworthia cymbiformis] Length = 155 Score = 253 bits (645), Expect = 2e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDA+RKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAVRKKEETHRMAEANRAFAHFR 155 >gb|AEX94145.1| ribosomal protein S7 (chloroplast) [Tulbaghia violacea] Length = 155 Score = 253 bits (645), Expect = 2e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARR+GGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRIGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_004733373.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_004733386.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] ref|YP_009255653.1| ribosomal protein S7 (chloroplast) [Cornus controversa] ref|YP_009255666.1| ribosomal protein S7 (chloroplast) [Cornus controversa] sp|Q6EMA2.1|RR7_CORMA RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64539.1| ribosomal protein S7 (chloroplast) [Cornus mas] gb|ADD29903.1| ribosomal protein S7 (chloroplast) [Cornus florida] gb|ADK89909.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|ADK89923.1| ribosomal protein S7 (chloroplast) [Crithmum maritimum] gb|AEK71692.1| ribosomal protein S7 (plastid) [Cornus florida] gb|AND96927.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AND96928.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF33144.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33145.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33824.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF33825.1| ribosomal protein S7 (chloroplast) [Cornus capitata] gb|AUF34334.1| ribosomal protein S7 (chloroplast) [Cornus controversa] gb|AUF34335.1| ribosomal protein S7 (chloroplast) [Cornus controversa] Length = 155 Score = 252 bits (644), Expect = 3e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AKR80664.1| ribosomal protein S7 (plastid) [Croomia japonica] gb|AKR81027.1| ribosomal protein S7 (plastid) [Stichoneuron caudatum] Length = 155 Score = 252 bits (644), Expect = 3e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRI+KHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRDMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_003434021.1| ribosomal protein S7 [Typha latifolia] ref|YP_003434034.1| ribosomal protein S7 [Typha latifolia] ref|YP_004563913.1| ribosomal protein S7 [Nelumbo lutea] ref|YP_004563926.1| ribosomal protein S7 [Nelumbo lutea] ref|YP_009093995.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] ref|YP_009094008.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] sp|Q67II8.1|RR7_TYPAN RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q6EM84.1|RR7_NELLU RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64557.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AAN32012.1| ribosomal protein S7 (chloroplast) [Talbotia elegans] gb|AAN32015.1| ribosomal protein S7 (chloroplast) [Typha angustifolia] gb|AAS65724.1| ribosomal protein S7 (chloroplast) [Sparganium eurycarpum] gb|AAZ03887.1| ribosomal protein S7, partial (chloroplast) [Typha latifolia] gb|ACN49370.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|ACN49384.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|ACN49455.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ACN49468.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ADA63745.1| ribosomal protein S7 (chloroplast) [Typha latifolia] gb|ADA63759.1| ribosomal protein S7 (chloroplast) [Typha latifolia] gb|ADD29896.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ADZ93754.1| ribosomal protein S7 (chloroplast) [Brocchinia micrantha] gb|ADZ93770.1| ribosomal protein S7 (chloroplast) [Stegolepis sp. Kubitki et al. 97-30] gb|AEK71648.1| ribosomal protein S7 (plastid) [Nelumbo nucifera] gb|AEX01252.1| ribosomal protein S7 (plastid) [Brocchinia micrantha] gb|AFG25682.1| ribosomal protein S7, partial (plastid) [Brocchinia micrantha] gb|AFG25700.1| ribosomal protein S7 (plastid) [Mayaca fluviatilis] gb|AFG25708.1| ribosomal protein S7, partial (plastid) [Potarophytum riparium] gb|AFG25712.1| ribosomal protein S7, partial (plastid) [Sparganium eurycarpum] gb|AFH01494.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AFH01509.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AFH01580.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AFH01586.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AGO98569.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AGO98582.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AIY33869.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AIY33882.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AKR80856.1| ribosomal protein S7 (plastid) [Xerophyta retinervis] Length = 155 Score = 252 bits (644), Expect = 3e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRI+KHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_004769759.1| ribosomal protein S7 [Magnolia kwangsiensis] ref|YP_004769772.1| ribosomal protein S7 [Magnolia kwangsiensis] ref|YP_006576159.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] ref|YP_006576174.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] ref|YP_007474414.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] ref|YP_007474426.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] ref|YP_007474497.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] ref|YP_007474510.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] ref|YP_007474581.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] ref|YP_007474594.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] ref|YP_008993222.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] ref|YP_008993235.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] ref|YP_008993308.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] ref|YP_008993321.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] ref|YP_008993394.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] ref|YP_008993407.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] ref|YP_008993480.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] ref|YP_008993493.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] ref|YP_008993566.1| ribosomal protein S7 (chloroplast) [Magnolia liliifera] ref|YP_008993579.1| ribosomal protein S7 (chloroplast) [Magnolia liliifera] ref|YP_008993652.1| ribosomal protein S7 (chloroplast) [Magnolia odora] ref|YP_008993665.1| ribosomal protein S7 (chloroplast) [Magnolia odora] ref|YP_008993824.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] ref|YP_008993837.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] ref|YP_008993910.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] ref|YP_008993923.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] ref|YP_008993738.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] ref|YP_008993751.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] ref|YP_009048334.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] ref|YP_009048351.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] ref|YP_009234686.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] ref|YP_009234699.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] ref|YP_009234940.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] ref|YP_009234953.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] ref|YP_009335633.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] ref|YP_009335646.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] ref|YP_009335718.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] ref|YP_009335731.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] ref|YP_009335803.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] ref|YP_009335816.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] ref|YP_009335887.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] ref|YP_009335899.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] ref|YP_009365621.1| ribosomal protein S7 (plastid) [Magnolia biondii] ref|YP_009365634.1| ribosomal protein S7 (plastid) [Magnolia biondii] ref|YP_009416782.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] ref|YP_009416795.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] ref|YP_009429847.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] ref|YP_009429860.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] ref|YP_009463138.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] ref|YP_009463151.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] ref|YP_009463224.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] ref|YP_009463237.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] ref|YP_009463310.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] ref|YP_009463323.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] ref|YP_009463396.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] ref|YP_009463409.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] ref|YP_009463482.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] ref|YP_009463495.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] ref|YP_009463568.1| ribosomal protein S7 (chloroplast) [Magnolia alba] ref|YP_009463581.1| ribosomal protein S7 (chloroplast) [Magnolia alba] sp|Q6KGX6.1|RR7_MAGST RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IA4.1|RR7_YUCGL RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ14218.1| ribosomal protein S7 (chloroplast) [Magnolia stellata] gb|AAQ64560.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|AAN32054.1| ribosomal protein S7 (chloroplast) [Lanaria lanata] gb|AAN32099.1| ribosomal protein S7 (chloroplast) [Yucca glauca] gb|AAZ03888.1| ribosomal protein S7, partial (chloroplast) [Yucca schidigera] gb|ADD29895.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|ADL39101.1| ribosomal protein S7 (chloroplast) [Magnolia kwangsiensis] gb|ADL39115.1| ribosomal protein S7 (chloroplast) [Magnolia kwangsiensis] gb|AEK71641.1| ribosomal protein S7 (plastid) [Meliosma aff. cuneifolia Moore 333] gb|AEK71829.1| ribosomal protein S7 (plastid) [Heisteria concinna] gb|AEM65262.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEM65277.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98296.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AEX98308.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AEX98379.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98392.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98546.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] gb|AEX98558.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] gb|AEX98629.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98642.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98713.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98726.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98797.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98810.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98963.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX98976.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX99132.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX99144.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AFP92354.1| ribosomal protein S7 (chloroplast) [Magnolia acuminata var. acuminata] gb|AFP92367.1| ribosomal protein S7 (chloroplast) [Magnolia acuminata var. acuminata] gb|AFP92441.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] gb|AFP92454.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] gb|AFP92527.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] gb|AFP92540.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] gb|AFP92613.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AFP92626.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AFP92699.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] gb|AFP92712.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] gb|AFP92785.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] gb|AFP92798.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] gb|AFP92871.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AFP92884.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AFP92957.1| ribosomal protein S7 (chloroplast) [Magnolia odora] gb|AFP92970.1| ribosomal protein S7 (chloroplast) [Magnolia odora] gb|AFP93043.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] gb|AFP93056.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] gb|AFP93129.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] gb|AFP93142.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] gb|AFP93215.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] gb|AFP93228.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] gb|AHF72125.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] gb|AHF72126.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] gb|AMD08404.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|AMD08417.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|AMD08658.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|AMD08671.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|APO12777.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] gb|APO12790.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] gb|APO12862.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] gb|APO12875.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] gb|APO12947.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] gb|APO12960.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] gb|APO13031.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] gb|APO13043.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] gb|ARJ61120.1| ribosomal protein S7 (plastid) [Magnolia biondii] gb|ARJ61121.1| ribosomal protein S7 (plastid) [Magnolia biondii] gb|ARJ62984.1| ribosomal protein S7 (plastid) [Magnolia officinalis] gb|ARJ62985.1| ribosomal protein S7 (plastid) [Magnolia officinalis] gb|ARJ63068.1| ribosomal protein S7 (plastid) [Magnolia denudata] gb|ARJ63069.1| ribosomal protein S7 (plastid) [Magnolia denudata] gb|ASF62374.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|ASF62375.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|ASS35052.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|ASS35053.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|ASX99475.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] gb|ASX99488.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] gb|AUW35367.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] gb|AUW35368.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] gb|AUW35453.1| ribosomal protein S7 (chloroplast) [Magnolia fordiana var. calcarea] gb|AUW35454.1| ribosomal protein S7 (chloroplast) [Magnolia fordiana var. calcarea] gb|AUW35539.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] gb|AUW35540.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] gb|AUW35625.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] gb|AUW35626.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] gb|AUW35711.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] gb|AUW35712.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] gb|AUW35797.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|AUW35798.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|AUW35883.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] gb|AUW35884.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] gb|AUW35969.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|AUW35970.1| ribosomal protein S7 (chloroplast) [Magnolia alba] Length = 155 Score = 252 bits (644), Expect = 3e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009409282.1| ribosomal protein S7 (chloroplast) [Aloe maculata] ref|YP_009409295.1| ribosomal protein S7 (chloroplast) [Aloe maculata] gb|APP88735.1| ribosomal protein S7 (chloroplast) [Aloe maculata] gb|APP88748.1| ribosomal protein S7 (chloroplast) [Aloe maculata] Length = 155 Score = 252 bits (643), Expect = 4e-83 Identities = 134/155 (86%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDA+RKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAVRKKEETHRMAEANRAFAHFR 155 >gb|AFG25696.1| ribosomal protein S7, partial (plastid) [Iris virginica] Length = 155 Score = 252 bits (643), Expect = 4e-83 Identities = 135/155 (87%), Positives = 136/155 (87%), Gaps = 12/155 (7%) Frame = +1 Query: 70 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 249 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 250 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK------------XXXXXXXAFKL 393 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGK AFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKL 120 Query: 394 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 498 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155