BLASTX nr result
ID: Acanthopanax23_contig00017287
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017287 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012090904.1| putative F-box/FBD/LRR-repeat protein At1g78... 57 1e-06 dbj|GAU15035.1| hypothetical protein TSUD_48310 [Trifolium subte... 55 6e-06 >ref|XP_012090904.1| putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] ref|XP_012090905.1| putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] ref|XP_012090906.1| putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] ref|XP_020540918.1| putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] gb|KDP21766.1| hypothetical protein JCGZ_00553 [Jatropha curcas] Length = 449 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Frame = -1 Query: 472 EIHNFSAGLKEELKLIKYFLKNAKVLKSMTISWGNGLDP----EIQKKLLKFPRGSFSCK 305 E+ F G + E+K+I+YFLKNAKVLK + I + + +DP ++ KKLLKFPR S +C+ Sbjct: 387 ELRGFE-GNRVEMKVIRYFLKNAKVLKKLAIEYLDDMDPKKETKLLKKLLKFPRASSTCQ 445 Query: 304 LNF 296 + F Sbjct: 446 IIF 448 >dbj|GAU15035.1| hypothetical protein TSUD_48310 [Trifolium subterraneum] Length = 404 Score = 55.5 bits (132), Expect = 6e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 448 LKEELKLIKYFLKNAKVLKSMTIS-WGNGLDPEIQKKLLKFPRGSFSCKLNF 296 L+ +LKL +Y L NA VL++MTIS WG+G EI+ +L +PRGS +C+L F Sbjct: 346 LEHDLKLARYILNNAGVLETMTISIWGDGEQHEIEMELSSYPRGSATCQLQF 397