BLASTX nr result
ID: Acanthopanax23_contig00017091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00017091 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW07422.1| hypothetical protein 0_1185_02, partial [Pinus ra... 67 5e-12 gb|AQK84958.1| RING/U-box superfamily protein [Zea mays] 68 4e-11 ref|XP_020978255.1| RING finger and transmembrane domain-contain... 67 5e-11 ref|XP_009783875.1| PREDICTED: RING finger and transmembrane dom... 69 5e-11 gb|OAO93600.1| hypothetical protein AXX17_AT5G01050 [Arabidopsis... 68 5e-11 ref|XP_017191539.1| PREDICTED: RING finger and transmembrane dom... 67 7e-11 ref|XP_022888377.1| RING finger and transmembrane domain-contain... 70 1e-10 ref|XP_022888376.1| E3 ubiquitin-protein ligase RNFT1-like isofo... 70 1e-10 ref|XP_017230053.1| PREDICTED: RING finger and transmembrane dom... 70 1e-10 ref|XP_011076564.1| RING finger and transmembrane domain-contain... 70 1e-10 ref|XP_021601833.1| RING finger and transmembrane domain-contain... 70 2e-10 ref|XP_015693316.1| PREDICTED: RING finger and transmembrane dom... 68 2e-10 ref|XP_022006561.1| RING finger and transmembrane domain-contain... 69 2e-10 gb|KVI10047.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 69 2e-10 dbj|GAV71421.1| hypothetical protein CFOL_v3_14915, partial [Cep... 66 2e-10 emb|CBI15794.3| unnamed protein product, partial [Vitis vinifera] 69 3e-10 emb|CBI31155.3| unnamed protein product, partial [Vitis vinifera] 69 3e-10 ref|XP_019077287.1| PREDICTED: RING finger and transmembrane dom... 69 3e-10 ref|XP_002275951.1| PREDICTED: RING finger and transmembrane dom... 69 3e-10 ref|XP_019076143.1| PREDICTED: RING finger and transmembrane dom... 69 3e-10 >gb|AEW07422.1| hypothetical protein 0_1185_02, partial [Pinus radiata] gb|AFG66620.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66621.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66622.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66623.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66624.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66625.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66626.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66627.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66628.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66629.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66630.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66631.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66632.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66633.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66634.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66635.1| hypothetical protein 0_1185_02, partial [Pinus taeda] gb|AFG66636.1| hypothetical protein 0_1185_02, partial [Pinus taeda] Length = 34 Score = 67.4 bits (163), Expect = 5e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD++S+GDGSTSLFFQLF Sbjct: 2 ERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 34 >gb|AQK84958.1| RING/U-box superfamily protein [Zea mays] Length = 148 Score = 68.2 bits (165), Expect = 4e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+S+GDGSTSLFFQLF Sbjct: 116 ERERTCPLCRALVKPADIRSFGDGSTSLFFQLF 148 >ref|XP_020978255.1| RING finger and transmembrane domain-containing protein 2-like [Arachis ipaensis] Length = 133 Score = 67.4 bits (163), Expect = 5e-11 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD++S+GDGSTSLFFQLF Sbjct: 101 ERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 133 >ref|XP_009783875.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Nicotiana sylvestris] Length = 182 Score = 68.6 bits (166), Expect = 5e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPAD++S+GDGSTSLFFQLF Sbjct: 150 ERERTCPLCRALVRPADLRSFGDGSTSLFFQLF 182 >gb|OAO93600.1| hypothetical protein AXX17_AT5G01050 [Arabidopsis thaliana] Length = 152 Score = 67.8 bits (164), Expect = 5e-11 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD+KS+GDGSTSLFFQ+F Sbjct: 120 ERERTCPLCRALVKPADLKSFGDGSTSLFFQIF 152 >ref|XP_017191539.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Malus domestica] Length = 148 Score = 67.4 bits (163), Expect = 7e-11 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD++S+GDGSTSLFFQLF Sbjct: 116 ERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 148 >ref|XP_022888377.1| RING finger and transmembrane domain-containing protein 2-like isoform X2 [Olea europaea var. sylvestris] Length = 457 Score = 70.1 bits (170), Expect = 1e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPAD++SYGDGSTSLFFQLF Sbjct: 425 ERERTCPLCRALVRPADLRSYGDGSTSLFFQLF 457 >ref|XP_022888376.1| E3 ubiquitin-protein ligase RNFT1-like isoform X1 [Olea europaea var. sylvestris] Length = 461 Score = 70.1 bits (170), Expect = 1e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPAD++SYGDGSTSLFFQLF Sbjct: 429 ERERTCPLCRALVRPADLRSYGDGSTSLFFQLF 461 >ref|XP_017230053.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] ref|XP_017230054.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] gb|KZN12130.1| hypothetical protein DCAR_004786 [Daucus carota subsp. sativus] Length = 460 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPADIKSYGDGSTSL FQLF Sbjct: 428 ERERTCPLCRALVRPADIKSYGDGSTSLLFQLF 460 >ref|XP_011076564.1| RING finger and transmembrane domain-containing protein 1 [Sesamum indicum] Length = 461 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPAD++SYGDGSTSLFFQLF Sbjct: 429 ERERTCPLCRALVRPADLQSYGDGSTSLFFQLF 461 >ref|XP_021601833.1| RING finger and transmembrane domain-containing protein 1-like [Manihot esculenta] gb|OAY24004.1| hypothetical protein MANES_18G124800 [Manihot esculenta] Length = 467 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+SYGDGSTSLFFQLF Sbjct: 435 ERERTCPLCRALVKPADIRSYGDGSTSLFFQLF 467 >ref|XP_015693316.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Oryza brachyantha] gb|AAV32165.1| unknown protein [Oryza sativa Japonica Group] Length = 251 Score = 68.2 bits (165), Expect = 2e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+S+GDGSTSLFFQLF Sbjct: 219 ERERTCPLCRALVKPADIRSFGDGSTSLFFQLF 251 >ref|XP_022006561.1| RING finger and transmembrane domain-containing protein 1-like [Helianthus annuus] gb|OTF99841.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 453 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPADI+S+GDGSTSLFFQLF Sbjct: 421 ERERTCPLCRALVRPADIRSFGDGSTSLFFQLF 453 >gb|KVI10047.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 470 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALVRPADI+S+GDGSTSLFFQLF Sbjct: 438 ERERTCPLCRALVRPADIRSFGDGSTSLFFQLF 470 >dbj|GAV71421.1| hypothetical protein CFOL_v3_14915, partial [Cephalotus follicularis] Length = 142 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+P D++S+GDGSTSLFFQLF Sbjct: 110 ERERTCPLCRALVKPTDLRSFGDGSTSLFFQLF 142 >emb|CBI15794.3| unnamed protein product, partial [Vitis vinifera] Length = 417 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+SYGDGSTSLFFQ+F Sbjct: 385 ERERTCPLCRALVKPADIRSYGDGSTSLFFQIF 417 >emb|CBI31155.3| unnamed protein product, partial [Vitis vinifera] Length = 418 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD++SYGDGSTSLFFQLF Sbjct: 386 ERERTCPLCRALVKPADLRSYGDGSTSLFFQLF 418 >ref|XP_019077287.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 isoform X2 [Vitis vinifera] Length = 434 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PAD++SYGDGSTSLFFQLF Sbjct: 402 ERERTCPLCRALVKPADLRSYGDGSTSLFFQLF 434 >ref|XP_002275951.1| PREDICTED: RING finger and transmembrane domain-containing protein 1 isoform X2 [Vitis vinifera] Length = 447 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+SYGDGSTSLFFQ+F Sbjct: 415 ERERTCPLCRALVKPADIRSYGDGSTSLFFQIF 447 >ref|XP_019076143.1| PREDICTED: RING finger and transmembrane domain-containing protein 1 isoform X1 [Vitis vinifera] ref|XP_019076144.1| PREDICTED: RING finger and transmembrane domain-containing protein 1 isoform X1 [Vitis vinifera] Length = 450 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 563 ERERTCPLCRALVRPADIKSYGDGSTSLFFQLF 465 ERERTCPLCRALV+PADI+SYGDGSTSLFFQ+F Sbjct: 418 ERERTCPLCRALVKPADIRSYGDGSTSLFFQIF 450