BLASTX nr result
ID: Acanthopanax23_contig00016301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00016301 (1046 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222334.1| hypothetical protein BevumaM_p100 (mitochond... 65 6e-09 dbj|BAD66717.1| orf169 (mitochondrion) [Beta vulgaris subsp. vul... 65 6e-09 ref|NP_064093.1| orf211 gene product (mitochondrion) [Beta vulga... 65 1e-08 >ref|YP_004222334.1| hypothetical protein BevumaM_p100 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842140.1| hypothetical protein BemaM_p096 (mitochondrion) [Beta macrocarpa] emb|CBJ14065.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ17556.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ20726.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX24945.1| hypothetical protein (mitochondrion) [Beta macrocarpa] emb|CBL51974.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 467 PRSVGPTTTRGNHTRTNEISLSLTLWRQKPVSPAKAHRGVSR 342 P+SVGPTTTR NHTRTNEI LSL + KPVSPA+AHRGVSR Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSR 101 >dbj|BAD66717.1| orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 169 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 467 PRSVGPTTTRGNHTRTNEISLSLTLWRQKPVSPAKAHRGVSR 342 P+SVGPTTTR NHTRTNEI LSL + KPVSPA+AHRGVSR Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSR 101 >ref|NP_064093.1| orf211 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] dbj|BAA99486.1| orf211 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 211 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 467 PRSVGPTTTRGNHTRTNEISLSLTLWRQKPVSPAKAHRGVSR 342 P+SVGPTTTR NHTRTNEI LSL + KPVSPA+AHRGVSR Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSR 101