BLASTX nr result
ID: Acanthopanax23_contig00015045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00015045 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021677531.1| inactive TPR repeat-containing thioredoxin T... 56 4e-06 >ref|XP_021677531.1| inactive TPR repeat-containing thioredoxin TTL3-like [Hevea brasiliensis] Length = 690 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +1 Query: 124 AKIY-RLGQIENARRHLCFHEQQPDTTELQKLHSLE 228 A +Y RLGQ+ENAR+HLCFH QQP TELQKL SLE Sbjct: 298 ASLYLRLGQVENARQHLCFHGQQPAPTELQKLQSLE 333