BLASTX nr result
ID: Acanthopanax23_contig00015019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00015019 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP07461.1| hypothetical protein CCACVL1_01298 [Corchorus cap... 59 3e-09 gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 57 6e-08 >gb|OMP07461.1| hypothetical protein CCACVL1_01298 [Corchorus capsularis] gb|OMP14090.1| ATP synthase subunit a chloroplastic [Corchorus olitorius] Length = 31 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 382 MTGLEPVTFFTQNKGATKLRYIPFNWSTVSL 290 MTG EPVTF TQNK ATKLRYIPFNWST+SL Sbjct: 1 MTGFEPVTFCTQNKRATKLRYIPFNWSTMSL 31 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 56.6 bits (135), Expect = 6e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 314 RDVAQLGSAFVLGKKCHGFQSCHPYL 391 RDVAQLGSAFVLG KCHGF+SCHPYL Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYL 26