BLASTX nr result
ID: Acanthopanax23_contig00014945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014945 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017243555.1| PREDICTED: peroxisomal and mitochondrial div... 76 2e-13 >ref|XP_017243555.1| PREDICTED: peroxisomal and mitochondrial division factor 2 [Daucus carota subsp. sativus] gb|KZM99324.1| hypothetical protein DCAR_013314 [Daucus carota subsp. sativus] Length = 330 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -3 Query: 443 INGKDVGLERGVVDDEEKGLMGLNLEWPLVAASAGTIALVAVVYLRYLRQR 291 +NG DV +ERG+V D+EKG MG NLEWP++AASAG IAL+AVVYL + +QR Sbjct: 280 MNGDDVVIERGIVGDDEKGFMGFNLEWPIMAASAGAIALLAVVYLHHTKQR 330