BLASTX nr result
ID: Acanthopanax23_contig00014713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014713 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ15688.1| putative endopeptidase Clp (chloroplast) [Rosa ch... 83 2e-17 ref|WP_082924819.1| hypothetical protein [Paenarthrobacter nicot... 75 1e-14 gb|ANY93398.3| ClpP (chloroplast) [Hagenia abyssinica] 74 1e-12 ref|YP_009334344.1| clp protease proteolytic subunit (chloroplas... 72 5e-12 gb|KCW54723.1| hypothetical protein EUGRSUZ_I00671 [Eucalyptus g... 64 5e-10 gb|AVI16583.1| caseinolytic mitochondrial matrix peptidase prote... 64 3e-09 ref|YP_009463956.1| ATP-dependent Clp protease proteolytic subun... 64 3e-09 gb|ANS80941.1| clpP-like protease (chloroplast) [Ilex pubescens] 64 4e-09 ref|YP_009411924.1| clpP-like protease (plastid) [Schima multibr... 64 4e-09 gb|AGZ19167.1| clp protease proteolytic subunit (chloroplast) [C... 64 4e-09 ref|YP_008520164.1| clpP-like protease (chloroplast) [Camellia t... 64 4e-09 ref|YP_008592782.1| clpP-like protease (chloroplast) [Camellia c... 64 4e-09 ref|YP_009415430.1| clpP-like protease (plastid) [Stewartia sine... 64 4e-09 ref|YP_009416039.1| clpP-like protease (plastid) [Stewartia cras... 64 4e-09 ref|YP_009415778.1| clpP-like protease (plastid) [Pyrenaria khas... 63 8e-09 ref|YP_009415604.1| clpP-like protease (plastid) [Pyrenaria ping... 63 8e-09 ref|YP_009415343.1| clpP-like protease (plastid) [Pyrenaria meng... 63 8e-09 gb|ASJ64323.1| clp protease proteolytic subunit (chloroplast) [E... 61 4e-08 gb|ANH20894.1| clp protease proteolytic subunit (chloroplast) [A... 61 4e-08 ref|YP_008081290.1| Clp protease proteolytic subunit (chloroplas... 60 6e-08 >gb|PRQ15688.1| putative endopeptidase Clp (chloroplast) [Rosa chinensis] Length = 110 Score = 82.8 bits (203), Expect = 2e-17 Identities = 47/65 (72%), Positives = 50/65 (76%) Frame = -2 Query: 195 MPVRLFNSIFFLVILYLSFFSLHHAK*RNFFNV*CYTIRVMIHQPASSFYEAQTGEFILE 16 MPVRLFN IF L+ILYL F + RN F V Y IRVMIHQPASSFYEAQTGEF+LE Sbjct: 1 MPVRLFNYIF-LIILYLLTFIMRDR--RNIFYVISYIIRVMIHQPASSFYEAQTGEFVLE 57 Query: 15 AEELL 1 AEELL Sbjct: 58 AEELL 62 >ref|WP_082924819.1| hypothetical protein [Paenarthrobacter nicotinovorans] Length = 109 Score = 75.5 bits (184), Expect = 1e-14 Identities = 43/65 (66%), Positives = 47/65 (72%) Frame = -2 Query: 195 MPVRLFNSIFFLVILYLSFFSLHHAK*RNFFNV*CYTIRVMIHQPASSFYEAQTGEFILE 16 MPVRL NSIF ++ F S H R+ + CY IRVMIHQPASSFYEAQTGEFILE Sbjct: 1 MPVRLLNSIFLFLLF---FISSPHLIMRDRGTI-CYIIRVMIHQPASSFYEAQTGEFILE 56 Query: 15 AEELL 1 AEELL Sbjct: 57 AEELL 61 >gb|ANY93398.3| ClpP (chloroplast) [Hagenia abyssinica] Length = 283 Score = 73.9 bits (180), Expect = 1e-12 Identities = 38/57 (66%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = -2 Query: 165 FLVILYLSFFSLHHAK*RNFF--NV*CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 FL+ LYL F HHA+ + F + Y IRVMIHQPASSFYEAQTGEF+LEAEELL Sbjct: 179 FLIFLYLPTFHFHHAREKKHFLGYIRYYIIRVMIHQPASSFYEAQTGEFVLEAEELL 235 >ref|YP_009334344.1| clp protease proteolytic subunit (chloroplast) [Agave attenuata] gb|APO11154.1| clp protease proteolytic subunit (chloroplast) [Agave attenuata] Length = 257 Score = 72.0 bits (175), Expect = 5e-12 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = -2 Query: 198 KMPVRLFNSI-FFLVILYLSFFSLHHAK*RNFF--NV*CYTIRVMIHQPASSFYEAQTGE 28 KMPVRLFNSI FF ++++LS + F +V IRVMIHQPASSFYEAQ GE Sbjct: 133 KMPVRLFNSICFFFLLVFLSLTLAQSCEIEEPFMHDVISNIIRVMIHQPASSFYEAQAGE 192 Query: 27 FILEAEELL 1 FILEAEELL Sbjct: 193 FILEAEELL 201 >gb|KCW54723.1| hypothetical protein EUGRSUZ_I00671 [Eucalyptus grandis] Length = 109 Score = 63.5 bits (153), Expect = 5e-10 Identities = 36/65 (55%), Positives = 43/65 (66%) Frame = -2 Query: 195 MPVRLFNSIFFLVILYLSFFSLHHAK*RNFFNV*CYTIRVMIHQPASSFYEAQTGEFILE 16 M VRL NSIF ++ F S H R+ + CY I++MIHQP SSFYEAQTGE I+E Sbjct: 1 MLVRLLNSIFLFLLF---FISSPHLIMRDRGTI-CYIIKIMIHQPVSSFYEAQTGEIIVE 56 Query: 15 AEELL 1 EELL Sbjct: 57 VEELL 61 >gb|AVI16583.1| caseinolytic mitochondrial matrix peptidase proteolytic subunit (chloroplast) [Camellia oleifera] Length = 200 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 122 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 152 >ref|YP_009463956.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] gb|AUW55410.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] Length = 204 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 126 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 156 >gb|ANS80941.1| clpP-like protease (chloroplast) [Ilex pubescens] Length = 212 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 134 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 164 >ref|YP_009411924.1| clpP-like protease (plastid) [Schima multibracteata] ref|YP_009411576.1| clpP-like protease (plastid) [Schima argentea] ref|YP_009411663.1| clpP-like protease (plastid) [Schima brevipedicellata] ref|YP_009411750.1| clpP-like protease (plastid) [Schima crenata] ref|YP_009411837.1| clpP-like protease (plastid) [Schima khasiana] ref|YP_009412011.1| clpP-like protease (plastid) [Schima noronhae] ref|YP_009412098.1| clpP-like protease (plastid) [Schima remotiserrata] ref|YP_009412185.1| clpP-like protease (plastid) [Schima sericans] ref|YP_009412272.1| clpP-like protease (plastid) [Schima sinensis] ref|YP_009412359.1| clpP-like protease (plastid) [Schima superba] ref|YP_009412446.1| clpP-like protease (plastid) [Schima wallichii] ref|YP_009415952.1| clpP-like protease (plastid) [Gordonia brandegeei] ref|YP_009418819.1| clpP-like protease (plastid) [Gordonia lasianthus] ref|YP_009418210.1| clpP-like protease (plastid) [Franklinia alatamaha] gb|ASK06558.1| clpP-like protease (plastid) [Schima argentea] gb|ASK06645.1| clpP-like protease (plastid) [Schima brevipedicellata] gb|ASK06732.1| clpP-like protease (plastid) [Schima crenata] gb|ASK06819.1| clpP-like protease (plastid) [Schima khasiana] gb|ASK06906.1| clpP-like protease (plastid) [Schima multibracteata] gb|ASK06993.1| clpP-like protease (plastid) [Schima noronhae] gb|ASK07080.1| clpP-like protease (plastid) [Schima remotiserrata] gb|ASK07167.1| clpP-like protease (plastid) [Schima sericans] gb|ASK07254.1| clpP-like protease (plastid) [Schima sinensis] gb|ASK07341.1| clpP-like protease (plastid) [Schima superba] gb|ASK07428.1| clpP-like protease (plastid) [Schima wallichii] gb|ASM43019.1| clpP-like protease (plastid) [Gordonia brandegeei] gb|ASM43976.1| clpP-like protease (plastid) [Franklinia alatamaha] gb|ASM44701.1| clpP-like protease (plastid) [Schima brevipedicellata] gb|ASM45020.1| clpP-like protease (plastid) [Gordonia lasianthus] Length = 214 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 166 >gb|AGZ19167.1| clp protease proteolytic subunit (chloroplast) [Camellia sinensis] gb|AIP85246.1| ClpP (chloroplast) [Camellia sinensis] Length = 214 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 166 >ref|YP_008520164.1| clpP-like protease (chloroplast) [Camellia taliensis] ref|YP_008592869.1| clpP-like protease (chloroplast) [Camellia danzaiensis] ref|YP_008592958.1| clpP-like protease (chloroplast) [Camellia impressinervis] ref|YP_008593136.1| clpP-like protease (chloroplast) [Camellia yunnanensis] ref|YP_008593047.1| clpP-like protease (chloroplast) [Camellia pitardii] ref|YP_009047957.1| clpP-like protease (chloroplast) [Camellia crapnelliana] ref|YP_009415517.1| clpP-like protease (plastid) [Apterosperma oblata] ref|YP_009415691.1| clpP-like protease (plastid) [Polyspora speciosa] ref|YP_009415865.1| clpP-like protease (plastid) [Polyspora axillaris] ref|YP_009416126.1| clpP-like protease (plastid) [Polyspora dalgleishiana] ref|YP_009416387.1| clpP-like protease (plastid) [Camellia szechuanensis] ref|YP_009417862.1| clpP-like protease (plastid) [Camellia mairei] ref|YP_009417949.1| clpP-like protease (plastid) [Polyspora longicarpa] ref|YP_009418297.1| clpP-like protease (plastid) [Polyspora hainanensis] ref|YP_009418906.1| clpP-like protease (plastid) [Gordonia fruticosa] ref|YP_009457969.1| clp protease proteolytic subunit (chloroplast) [Camellia japonica] gb|AGU44311.1| clpP-like protease (chloroplast) [Camellia danzaiensis] gb|AGU44398.1| clpP-like protease (chloroplast) [Camellia impressinervis] gb|AGU44487.1| clpP-like protease (chloroplast) [Camellia taliensis] gb|AGU44576.1| clpP-like protease (chloroplast) [Camellia pitardii] gb|AGU44665.1| clpP-like protease (chloroplast) [Camellia yunnanensis] gb|AGU44754.1| clpP-like protease (chloroplast) [Camellia taliensis] gb|AHF71563.1| clpP-like protease (chloroplast) [Camellia crapnelliana] gb|ASM42236.1| clpP-like protease (plastid) [Camellia oleifera] gb|ASM42323.1| clpP-like protease (plastid) [Apterosperma oblata] gb|ASM42584.1| clpP-like protease (plastid) [Polyspora speciosa] gb|ASM42845.1| clpP-like protease (plastid) [Camellia tachangensis var. remotiserrata] gb|ASM42932.1| clpP-like protease (plastid) [Polyspora axillaris] gb|ASM43367.1| clpP-like protease (plastid) [Camellia mairei] gb|ASM43454.1| clpP-like protease (plastid) [Polyspora longicarpa] gb|ASM43541.1| clpP-like protease (plastid) [Polyspora dalgleishiana] gb|ASM44150.1| clpP-like protease (plastid) [Polyspora hainanensis] gb|ASM44324.1| clpP-like protease (plastid) [Camellia szechuanensis] gb|ASM45194.1| clpP-like protease (plastid) [Gordonia fruticosa] gb|ASM45281.1| clpP-like protease (plastid) [Camellia reticulata] gb|AUO29285.1| clp protease proteolytic subunit (chloroplast) [Camellia japonica] gb|AVN90010.1| clpP-like protease (chloroplast) [Camellia chekiangoleosa] Length = 214 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 166 >ref|YP_008592782.1| clpP-like protease (chloroplast) [Camellia cuspidata] ref|YP_009416474.1| clpP-like protease (plastid) [Camellia elongata] gb|AGU44222.1| clpP-like protease (chloroplast) [Camellia cuspidata] gb|ASM45107.1| clpP-like protease (plastid) [Camellia elongata] Length = 214 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 166 >ref|YP_009415430.1| clpP-like protease (plastid) [Stewartia sinensis] ref|YP_009416300.1| clpP-like protease (plastid) [Stewartia rubiginosa] ref|YP_009418645.1| clpP-like protease (plastid) [Stewartia pseudocamellia] ref|YP_009418732.1| clpP-like protease (plastid) [Stewartia rostrata] gb|ASM42177.1| clpP-like protease (plastid) [Stewartia sinensis] gb|ASM44237.1| clpP-like protease (plastid) [Stewartia rubiginosa] gb|ASM44846.1| clpP-like protease (plastid) [Stewartia pseudocamellia] gb|ASM44961.1| clpP-like protease (plastid) [Stewartia rostrata] Length = 216 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 138 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 168 >ref|YP_009416039.1| clpP-like protease (plastid) [Stewartia crassifolia] ref|YP_009416213.1| clpP-like protease (plastid) [Stewartia cordifolia] ref|YP_009418123.1| clpP-like protease (plastid) [Stewartia malacodendron] ref|YP_009418036.1| clpP-like protease (plastid) [Stewartia pteropetiolata] ref|YP_009418471.1| clpP-like protease (plastid) [Stewartia ovata] ref|YP_009418558.1| clpP-like protease (plastid) [Stewartia calcicola] gb|ASM43280.1| clpP-like protease (plastid) [Stewartia crassifolia] gb|ASM43628.1| clpP-like protease (plastid) [Stewartia pteropetiolata] gb|ASM43917.1| clpP-like protease (plastid) [Stewartia malacodendron] gb|ASM44063.1| clpP-like protease (plastid) [Stewartia cordifolia] gb|ASM44498.1| clpP-like protease (plastid) [Stewartia ovata] gb|ASM44585.1| clpP-like protease (plastid) [Stewartia calcicola] Length = 216 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 138 CYIIRVMIHQPASSFYEAQTGEFILEAEELL 168 >ref|YP_009415778.1| clpP-like protease (plastid) [Pyrenaria khasiana] gb|ASM42671.1| clpP-like protease (plastid) [Pyrenaria khasiana] Length = 214 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEF+LEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFLLEAEELL 166 >ref|YP_009415604.1| clpP-like protease (plastid) [Pyrenaria pingpienensis] ref|YP_009417688.1| clpP-like protease (plastid) [Pyrenaria microcarpa] ref|YP_009417775.1| clpP-like protease (plastid) [Tutcheria championii] ref|YP_009418384.1| clpP-like protease (plastid) [Pyrenaria oblongicarpa] ref|YP_009419254.1| clpP-like protease (plastid) [Pyrenaria diospyricarpa] gb|ASM42410.1| clpP-like protease (plastid) [Pyrenaria pingpienensis] gb|ASM42497.1| clpP-like protease (plastid) [Pyrenaria spectabilis var. greeniae] gb|ASM42758.1| clpP-like protease (plastid) [Pyrenaria spectabilis var. greeniae] gb|ASM43106.1| clpP-like protease (plastid) [Pyrenaria microcarpa] gb|ASM43193.1| clpP-like protease (plastid) [Tutcheria championii] gb|ASM43715.1| clpP-like protease (plastid) [Pyrenaria hirta var. hirta] gb|ASM43802.1| clpP-like protease (plastid) [Pyrenaria jonquieriana subsp. multisepala] gb|ASM44410.1| clpP-like protease (plastid) [Pyrenaria oblongicarpa] gb|ASM44759.1| clpP-like protease (plastid) [Pyrenaria hirta var. cordatula] gb|ASM45629.1| clpP-like protease (plastid) [Pyrenaria diospyricarpa] Length = 214 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEF+LEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFLLEAEELL 166 >ref|YP_009415343.1| clpP-like protease (plastid) [Pyrenaria menglaensis] gb|ASM42062.1| clpP-like protease (plastid) [Pyrenaria menglaensis] Length = 214 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 93 CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 CY IRVMIHQPASSFYEAQTGEF+LEAEELL Sbjct: 136 CYIIRVMIHQPASSFYEAQTGEFLLEAEELL 166 >gb|ASJ64323.1| clp protease proteolytic subunit (chloroplast) [Euclidium syriacum] Length = 205 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 126 HAK*RNFFNV*CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 HAK N+ Y IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 121 HAK-----NLFYYIIRVMIHQPASSFYEAQTGEFILEAEELL 157 >gb|ANH20894.1| clp protease proteolytic subunit (chloroplast) [Arabidopsis halleri subsp. gemmifera] gb|ANH20980.1| clp protease proteolytic subunit (chloroplast) [Arabidopsis lyrata subsp. petraea] gb|ASJ64151.1| clp protease proteolytic subunit (chloroplast) [Bunias orientalis] Length = 205 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 126 HAK*RNFFNV*CYTIRVMIHQPASSFYEAQTGEFILEAEELL 1 HAK N+ Y IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 121 HAK-----NLFYYIIRVMIHQPASSFYEAQTGEFILEAEELL 157 >ref|YP_008081290.1| Clp protease proteolytic subunit (chloroplast) (chloroplast) [Catharanthus roseus] gb|AGI51169.1| Clp protease proteolytic subunit (chloroplast) [Catharanthus roseus] Length = 202 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 90 YTIRVMIHQPASSFYEAQTGEFILEAEELL 1 Y IRVMIHQPASSFYEAQTGEFILEAEELL Sbjct: 125 YIIRVMIHQPASSFYEAQTGEFILEAEELL 154