BLASTX nr result
ID: Acanthopanax23_contig00014667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014667 (695 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM95102.1| hypothetical protein DCAR_018344 [Daucus carota s... 59 3e-06 ref|XP_017253169.1| PREDICTED: homeobox protein LUMINIDEPENDENS ... 59 3e-06 ref|XP_017253168.1| PREDICTED: homeobox protein LUMINIDEPENDENS ... 59 3e-06 ref|XP_017253167.1| PREDICTED: homeobox protein LUMINIDEPENDENS ... 59 3e-06 >gb|KZM95102.1| hypothetical protein DCAR_018344 [Daucus carota subsp. sativus] Length = 944 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -1 Query: 257 PPRNRNEIMVDPWYESWSPDNSPIRSQPG-WNYDEPRMNMG 138 PP NRNE + D WY++WSPDNSP+RSQP W+Y + R G Sbjct: 869 PPSNRNETVGDTWYDTWSPDNSPVRSQPPVWSYGQARTTNG 909 >ref|XP_017253169.1| PREDICTED: homeobox protein LUMINIDEPENDENS isoform X3 [Daucus carota subsp. sativus] Length = 960 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -1 Query: 257 PPRNRNEIMVDPWYESWSPDNSPIRSQPG-WNYDEPRMNMG 138 PP NRNE + D WY++WSPDNSP+RSQP W+Y + R G Sbjct: 885 PPSNRNETVGDTWYDTWSPDNSPVRSQPPVWSYGQARTTNG 925 >ref|XP_017253168.1| PREDICTED: homeobox protein LUMINIDEPENDENS isoform X2 [Daucus carota subsp. sativus] Length = 960 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -1 Query: 257 PPRNRNEIMVDPWYESWSPDNSPIRSQPG-WNYDEPRMNMG 138 PP NRNE + D WY++WSPDNSP+RSQP W+Y + R G Sbjct: 885 PPSNRNETVGDTWYDTWSPDNSPVRSQPPVWSYGQARTTNG 925 >ref|XP_017253167.1| PREDICTED: homeobox protein LUMINIDEPENDENS isoform X1 [Daucus carota subsp. sativus] Length = 961 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -1 Query: 257 PPRNRNEIMVDPWYESWSPDNSPIRSQPG-WNYDEPRMNMG 138 PP NRNE + D WY++WSPDNSP+RSQP W+Y + R G Sbjct: 886 PPSNRNETVGDTWYDTWSPDNSPVRSQPPVWSYGQARTTNG 926