BLASTX nr result
ID: Acanthopanax23_contig00014410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014410 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE96986.1| putative ribonuclease h protein [Quercus suber] 47 6e-06 >gb|POE96986.1| putative ribonuclease h protein [Quercus suber] Length = 177 Score = 46.6 bits (109), Expect(2) = 6e-06 Identities = 21/45 (46%), Positives = 29/45 (64%) Frame = +2 Query: 434 PSKGGAASVLRDSNGTWIAGTSRNLVGVSVAVTEFLAIRDGLSLA 568 PSK GA ++RDS+G W+ G R++ + EF A+RDGL LA Sbjct: 65 PSKAGAGGLIRDSSGHWVKGFVRSIGFATSVTAEFWALRDGLKLA 109 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 373 PPQGWIKINSDGKLGDCCSRSLKGG 447 PP+GW K+N+DG G S++ GG Sbjct: 48 PPEGWFKLNTDGASGGNPSKAGAGG 72