BLASTX nr result
ID: Acanthopanax23_contig00014363
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014363 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN10109.1| hypothetical protein DCAR_002765 [Daucus carota s... 59 7e-07 ref|XP_017227818.1| PREDICTED: sugar transporter ERD6-like 7 [Da... 59 7e-07 ref|XP_012829882.1| PREDICTED: sugar transporter ERD6-like 7 [Er... 58 1e-06 ref|XP_019197529.1| PREDICTED: sugar transporter ERD6-like 7 [Ip... 56 5e-06 ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fr... 56 5e-06 ref|XP_017982887.1| PREDICTED: sugar transporter ERD6-like 7 [Th... 56 5e-06 gb|KDO87479.1| hypothetical protein CISIN_1g033094mg [Citrus sin... 54 5e-06 emb|CBI32306.3| unnamed protein product, partial [Vitis vinifera] 55 8e-06 gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [... 55 8e-06 gb|KZV32393.1| hypothetical protein F511_03676 [Dorcoceras hygro... 55 8e-06 ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vi... 55 8e-06 >gb|KZN10109.1| hypothetical protein DCAR_002765 [Daucus carota subsp. sativus] Length = 421 Score = 58.5 bits (140), Expect = 7e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINAS 411 LYA IN LA+VFVI+IVPETKGRTLEQIQ+T+N+S Sbjct: 387 LYAAINALAIVFVIMIVPETKGRTLEQIQSTLNSS 421 >ref|XP_017227818.1| PREDICTED: sugar transporter ERD6-like 7 [Daucus carota subsp. sativus] Length = 473 Score = 58.5 bits (140), Expect = 7e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINAS 411 LYA IN LA+VFVI+IVPETKGRTLEQIQ+T+N+S Sbjct: 439 LYAAINALAIVFVIMIVPETKGRTLEQIQSTLNSS 473 >ref|XP_012829882.1| PREDICTED: sugar transporter ERD6-like 7 [Erythranthe guttata] gb|EYU43551.1| hypothetical protein MIMGU_mgv1a005532mg [Erythranthe guttata] Length = 480 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINAS 411 LYA +N LA+VFVI +VPETKGRTLEQIQT INAS Sbjct: 446 LYAAVNALAIVFVIKVVPETKGRTLEQIQTAINAS 480 >ref|XP_019197529.1| PREDICTED: sugar transporter ERD6-like 7 [Ipomoea nil] Length = 472 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 LYA IN+LA++FVI +VPETKGRTLEQIQ TINA Sbjct: 439 LYATINVLAILFVIKVVPETKGRTLEQIQATINA 472 >ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. vesca] Length = 476 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTIN 417 LYAVIN+LA++F++++VPETKGRTLEQIQ +IN Sbjct: 443 LYAVINVLAIIFIVVMVPETKGRTLEQIQASIN 475 >ref|XP_017982887.1| PREDICTED: sugar transporter ERD6-like 7 [Theobroma cacao] ref|XP_017982894.1| PREDICTED: sugar transporter ERD6-like 7 [Theobroma cacao] ref|XP_007050716.2| PREDICTED: sugar transporter ERD6-like 7 [Theobroma cacao] ref|XP_017982901.1| PREDICTED: sugar transporter ERD6-like 7 [Theobroma cacao] Length = 484 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 LYAVIN LA++FV+I+VPETKG+TLEQIQ INA Sbjct: 451 LYAVINALAILFVVIVVPETKGKTLEQIQAAINA 484 >gb|KDO87479.1| hypothetical protein CISIN_1g033094mg [Citrus sinensis] Length = 127 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 LYA IN L ++F+II+VPETKGRTLEQIQ INA Sbjct: 94 LYAAINALGILFMIIVVPETKGRTLEQIQAAINA 127 >emb|CBI32306.3| unnamed protein product, partial [Vitis vinifera] Length = 437 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 +Y VIN LA+VFV+ +VPETKGRTLEQIQ TINA Sbjct: 404 IYGVINALAIVFVVKVVPETKGRTLEQIQATINA 437 >gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gb|EOX94873.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 484 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 +YAVIN LA++FV+I+VPETKG+TLEQIQ INA Sbjct: 451 IYAVINALAILFVVIVVPETKGKTLEQIQAAINA 484 >gb|KZV32393.1| hypothetical protein F511_03676 [Dorcoceras hygrometricum] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTIN 417 LYA IN LA+VFVI++VPETKGRTLEQIQ IN Sbjct: 453 LYAAINALAIVFVIVVVPETKGRTLEQIQAAIN 485 >ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vitis vinifera] gb|ADP37173.1| putative ERD6-like transporter [Vitis vinifera] Length = 490 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 515 LYAVINLLAMVFVIIIVPETKGRTLEQIQTTINA 414 +Y VIN LA+VFV+ +VPETKGRTLEQIQ TINA Sbjct: 457 IYGVINALAIVFVVKVVPETKGRTLEQIQATINA 490