BLASTX nr result
ID: Acanthopanax23_contig00014282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00014282 (805 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX56991.1| ATP-dependent RNA helicase DHX36-like protein, pa... 60 1e-07 gb|PNX68245.1| ATP-dependent RNA helicase DHX36-like protein [Tr... 60 2e-07 gb|KYP51613.1| putative ATP-dependent RNA helicase DHX36 [Cajanu... 62 2e-07 ref|XP_020231131.1| DExH-box ATP-dependent RNA helicase DExH3 [C... 62 3e-07 gb|PNX68222.1| ATP-dependent RNA helicase DHX36-like protein [Tr... 60 3e-07 ref|XP_020976080.1| DExH-box ATP-dependent RNA helicase DExH3 is... 61 7e-07 ref|XP_022632724.1| DExH-box ATP-dependent RNA helicase DExH3 is... 61 7e-07 ref|XP_016196900.1| DExH-box ATP-dependent RNA helicase DExH3 is... 61 7e-07 ref|XP_014524279.1| DExH-box ATP-dependent RNA helicase DExH3 is... 61 7e-07 dbj|GAV85634.1| dsrm domain-containing protein/DEAD domain-conta... 61 1e-06 gb|OVA00884.1| Helicase [Macleaya cordata] 61 1e-06 gb|KRH13103.1| hypothetical protein GLYMA_15G216000, partial [Gl... 60 1e-06 ref|XP_007133513.1| hypothetical protein PHAVU_011G1853000g, par... 60 2e-06 gb|KHN24317.1| Putative ATP-dependent RNA helicase DHX36 [Glycin... 60 2e-06 gb|KRH44758.1| hypothetical protein GLYMA_08G229400 [Glycine max] 60 2e-06 gb|KHN38137.1| Putative ATP-dependent RNA helicase DHX36 [Glycin... 60 2e-06 ref|XP_006585701.1| PREDICTED: ATP-dependent RNA helicase DHX36-... 60 2e-06 dbj|GAU30411.1| hypothetical protein TSUD_364570 [Trifolium subt... 60 2e-06 ref|XP_014623221.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependen... 60 2e-06 ref|XP_004511172.1| PREDICTED: ATP-dependent RNA helicase DHX36 ... 60 2e-06 >gb|PNX56991.1| ATP-dependent RNA helicase DHX36-like protein, partial [Trifolium pratense] Length = 136 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 91 AAIEALAWLTHTSDNTQHEDDKSPPDVTDNM 121 >gb|PNX68245.1| ATP-dependent RNA helicase DHX36-like protein [Trifolium pratense] Length = 158 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 113 AAIEALAWLTHTSDNTQHEDDKSPPDVTDNM 143 >gb|KYP51613.1| putative ATP-dependent RNA helicase DHX36 [Cajanus cajan] Length = 476 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDDN+PPDV+DNM Sbjct: 431 AAIEALAWLTHTSDNNQHEDDNSPPDVTDNM 461 >ref|XP_020231131.1| DExH-box ATP-dependent RNA helicase DExH3 [Cajanus cajan] Length = 1154 Score = 62.4 bits (150), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDDN+PPDV+DNM Sbjct: 1109 AAIEALAWLTHTSDNNQHEDDNSPPDVTDNM 1139 >gb|PNX68222.1| ATP-dependent RNA helicase DHX36-like protein [Trifolium pratense] Length = 179 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 134 AAIEALAWLTHTSDNTQHEDDKSPPDVTDNM 164 >ref|XP_020976080.1| DExH-box ATP-dependent RNA helicase DExH3 isoform X2 [Arachis ipaensis] Length = 933 Score = 61.2 bits (147), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q EDDN+PPDV+DNM Sbjct: 888 AAIEALAWLTHTSDNYQQEDDNSPPDVTDNM 918 >ref|XP_022632724.1| DExH-box ATP-dependent RNA helicase DExH3 isoform X2 [Vigna radiata var. radiata] Length = 1086 Score = 61.2 bits (147), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q EDDN+PPDV+DNM Sbjct: 1041 AAIEALAWLTHTSDNNQPEDDNSPPDVTDNM 1071 >ref|XP_016196900.1| DExH-box ATP-dependent RNA helicase DExH3 isoform X1 [Arachis ipaensis] Length = 1132 Score = 61.2 bits (147), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q EDDN+PPDV+DNM Sbjct: 1087 AAIEALAWLTHTSDNYQQEDDNSPPDVTDNM 1117 >ref|XP_014524279.1| DExH-box ATP-dependent RNA helicase DExH3 isoform X1 [Vigna radiata var. radiata] Length = 1153 Score = 61.2 bits (147), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q EDDN+PPDV+DNM Sbjct: 1108 AAIEALAWLTHTSDNNQPEDDNSPPDVTDNM 1138 >dbj|GAV85634.1| dsrm domain-containing protein/DEAD domain-containing protein/Helicase_C domain-containing protein/HA2 domain-containing protein/OB_NTP_bind domain-containing protein [Cephalotus follicularis] Length = 1151 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AA+EALAWLTHTSDN QNEDD++PPDV+DNM Sbjct: 1106 AAVEALAWLTHTSDNIQNEDDDSPPDVTDNM 1136 >gb|OVA00884.1| Helicase [Macleaya cordata] Length = 1160 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN ++EDDN+PPDV+DNM Sbjct: 1115 AAIEALAWLTHTSDNNRDEDDNSPPDVTDNM 1145 >gb|KRH13103.1| hypothetical protein GLYMA_15G216000, partial [Glycine max] Length = 338 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPD++DNM Sbjct: 293 AAIEALAWLTHTSDNNQHEDDKSPPDITDNM 323 >ref|XP_007133513.1| hypothetical protein PHAVU_011G1853000g, partial [Phaseolus vulgaris] gb|ESW05507.1| hypothetical protein PHAVU_011G1853000g, partial [Phaseolus vulgaris] Length = 668 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 623 AAIEALAWLTHTSDNNQHEDDKSPPDVTDNM 653 >gb|KHN24317.1| Putative ATP-dependent RNA helicase DHX36 [Glycine soja] Length = 412 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPD++DNM Sbjct: 367 AAIEALAWLTHTSDNNQHEDDKSPPDITDNM 397 >gb|KRH44758.1| hypothetical protein GLYMA_08G229400 [Glycine max] Length = 1057 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 1012 AAIEALAWLTHTSDNNQHEDDKSPPDVTDNM 1042 >gb|KHN38137.1| Putative ATP-dependent RNA helicase DHX36 [Glycine soja] Length = 1133 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 1088 AAIEALAWLTHTSDNNQHEDDKSPPDVTDNM 1118 >ref|XP_006585701.1| PREDICTED: ATP-dependent RNA helicase DHX36-like [Glycine max] gb|KRH44757.1| hypothetical protein GLYMA_08G229400 [Glycine max] Length = 1161 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 1116 AAIEALAWLTHTSDNNQHEDDKSPPDVTDNM 1146 >dbj|GAU30411.1| hypothetical protein TSUD_364570 [Trifolium subterraneum] Length = 566 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 521 AAIEALAWLTHTSDNTQHEDDKSPPDVTDNM 551 >ref|XP_014623221.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX36 [Glycine max] Length = 834 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPD++DNM Sbjct: 789 AAIEALAWLTHTSDNNQHEDDKSPPDITDNM 819 >ref|XP_004511172.1| PREDICTED: ATP-dependent RNA helicase DHX36 [Cicer arietinum] Length = 1149 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 804 AAIEALAWLTHTSDNKQNEDDNAPPDVSDNM 712 AAIEALAWLTHTSDN Q+EDD +PPDV+DNM Sbjct: 1104 AAIEALAWLTHTSDNTQHEDDKSPPDVNDNM 1134