BLASTX nr result
ID: Acanthopanax23_contig00012809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00012809 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM87415.1| hypothetical protein DCAR_024549 [Daucus carota s... 60 1e-07 ref|XP_017219359.1| PREDICTED: uncharacterized protein LOC108196... 60 1e-07 >gb|KZM87415.1| hypothetical protein DCAR_024549 [Daucus carota subsp. sativus] Length = 329 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 6 LAAALQADIPAMVKGLLDSGLEVNVDTEDLMKKDLLC 116 LAAALQADIPAMV GL++ GL+VNV TEDL+ KDLLC Sbjct: 293 LAAALQADIPAMVNGLVELGLDVNVSTEDLLAKDLLC 329 >ref|XP_017219359.1| PREDICTED: uncharacterized protein LOC108196548 [Daucus carota subsp. sativus] ref|XP_017219360.1| PREDICTED: uncharacterized protein LOC108196548 [Daucus carota subsp. sativus] Length = 391 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 6 LAAALQADIPAMVKGLLDSGLEVNVDTEDLMKKDLLC 116 LAAALQADIPAMV GL++ GL+VNV TEDL+ KDLLC Sbjct: 355 LAAALQADIPAMVNGLVELGLDVNVSTEDLLAKDLLC 391