BLASTX nr result
ID: Acanthopanax23_contig00011713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00011713 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJK30632.1| squalene synthase [Panax ginseng] 119 2e-29 gb|ACV88718.1| squalene synthase [Panax ginseng] 119 2e-29 emb|CAJ58419.1| squalene synthase [Panax quinquefolius] 119 2e-29 emb|CAJ58418.1| squalene synthase [Panax quinquefolius] 119 2e-29 gb|AJK30633.1| squalene synthase [Panax ginseng] 119 3e-29 gb|ACZ71037.1| squalene synthase [Panax ginseng] 119 3e-29 gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus] >g... 118 7e-29 gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus] >g... 118 7e-29 gb|AJK30626.1| squalene synthase [Panax ginseng] 104 9e-24 gb|AJK30628.1| squalene synthase [Panax ginseng] 104 1e-23 gb|AJK30627.1| squalene synthase [Panax ginseng] >gi|755573274|g... 104 1e-23 gb|AUZ98402.1| squalene synthase [Trachyspermum ammi] 102 9e-23 gb|ADC32654.1| squalene synthase [Aralia elata] 100 2e-22 ref|XP_017215009.1| PREDICTED: squalene synthase-like [Daucus ca... 100 2e-22 gb|AER23670.1| squalene synthase [Eleutherococcus senticosus] 99 1e-21 gb|AAV58897.1| squalene synthase [Centella asiatica] 99 2e-21 gb|AJK30634.1| squalene synthase [Panax ginseng] 98 2e-21 gb|ABA29019.1| squalene synthase [Panax notoginseng] >gi|5292762... 98 2e-21 gb|AIK21786.1| squalene synthase [Panax notoginseng] 98 2e-21 gb|AGI19256.1| squalene synthase [Panax notoginseng] 98 2e-21 >gb|AJK30632.1| squalene synthase [Panax ginseng] Length = 415 Score = 119 bits (299), Expect = 2e-29 Identities = 59/66 (89%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >gb|ACV88718.1| squalene synthase [Panax ginseng] Length = 415 Score = 119 bits (299), Expect = 2e-29 Identities = 59/66 (89%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >emb|CAJ58419.1| squalene synthase [Panax quinquefolius] Length = 415 Score = 119 bits (299), Expect = 2e-29 Identities = 59/66 (89%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >emb|CAJ58418.1| squalene synthase [Panax quinquefolius] Length = 415 Score = 119 bits (299), Expect = 2e-29 Identities = 59/66 (89%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >gb|AJK30633.1| squalene synthase [Panax ginseng] Length = 415 Score = 119 bits (298), Expect = 3e-29 Identities = 58/66 (87%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL +ILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIIILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >gb|ACZ71037.1| squalene synthase [Panax ginseng] Length = 415 Score = 119 bits (298), Expect = 3e-29 Identities = 58/66 (87%), Positives = 64/66 (96%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SGALTTKRKSYI+ENESGYNSTL +ILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIIILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 NLPN+L Sbjct: 410 NLPNSL 415 >gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus] gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus] gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus] Length = 415 Score = 118 bits (296), Expect = 7e-29 Identities = 58/66 (87%), Positives = 65/66 (98%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK+CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 +LPN+L Sbjct: 410 SLPNSL 415 >gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus] gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus] gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus] Length = 415 Score = 118 bits (296), Expect = 7e-29 Identities = 58/66 (87%), Positives = 65/66 (98%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK+CK+SGALTTKRKSYI+ENESGYNSTL VILFI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVILFIILAILYAYLSS 409 Query: 241 NLPNTL 224 +LPN+L Sbjct: 410 SLPNSL 415 >gb|AJK30626.1| squalene synthase [Panax ginseng] Length = 414 Score = 104 bits (260), Expect = 9e-24 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 408 Query: 241 NLPNTL 224 NLPN+L Sbjct: 409 NLPNSL 414 >gb|AJK30628.1| squalene synthase [Panax ginseng] Length = 444 Score = 104 bits (260), Expect = 1e-23 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 380 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 438 Query: 241 NLPNTL 224 NLPN+L Sbjct: 439 NLPNSL 444 >gb|AJK30627.1| squalene synthase [Panax ginseng] gb|AJK30629.1| squalene synthase [Panax ginseng] Length = 444 Score = 104 bits (260), Expect = 1e-23 Identities = 52/66 (78%), Positives = 61/66 (92%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 380 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 438 Query: 241 NLPNTL 224 NLPN+L Sbjct: 439 NLPNSL 444 >gb|AUZ98402.1| squalene synthase [Trachyspermum ammi] Length = 414 Score = 102 bits (253), Expect = 9e-23 Identities = 52/65 (80%), Positives = 58/65 (89%) Frame = -2 Query: 424 KDPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLS 245 +DPNAT T+SR+EAIQKTCKDSGALT KRKSYI+E ESGYNS L I+FI+LAILYAYLS Sbjct: 349 EDPNATITVSRLEAIQKTCKDSGALT-KRKSYIIEKESGYNSVLIAIIFIILAILYAYLS 407 Query: 244 SNLPN 230 SNL N Sbjct: 408 SNLSN 412 >gb|ADC32654.1| squalene synthase [Aralia elata] Length = 414 Score = 100 bits (250), Expect = 2e-22 Identities = 51/64 (79%), Positives = 58/64 (90%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FIMLAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIMLAILYAYLSS 408 Query: 241 NLPN 230 NL N Sbjct: 409 NLVN 412 >ref|XP_017215009.1| PREDICTED: squalene synthase-like [Daucus carota subsp. sativus] Length = 415 Score = 100 bits (250), Expect = 2e-22 Identities = 49/62 (79%), Positives = 55/62 (88%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNAT TLSR+EAIQKTCKDSGALT RKSYI+E+ESGYNS L I+ I+LA+LYAYLSS Sbjct: 350 DPNATITLSRLEAIQKTCKDSGALTKSRKSYIIESESGYNSVLIAIIIIILAVLYAYLSS 409 Query: 241 NL 236 NL Sbjct: 410 NL 411 >gb|AER23670.1| squalene synthase [Eleutherococcus senticosus] Length = 414 Score = 99.0 bits (245), Expect = 1e-21 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E++S +NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESKSAHNSALIAIIFIILAILYAYLSS 408 Query: 241 NLPN 230 NLPN Sbjct: 409 NLPN 412 >gb|AAV58897.1| squalene synthase [Centella asiatica] Length = 415 Score = 98.6 bits (244), Expect = 2e-21 Identities = 46/64 (71%), Positives = 55/64 (85%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQK CK+SG +T RKSY++EN+SGYN L ILFI+LA++YAYLSS Sbjct: 350 DPNATKTLSRLEAIQKKCKESGVITPNRKSYVLENDSGYNLVLIAILFIILALVYAYLSS 409 Query: 241 NLPN 230 NL N Sbjct: 410 NLSN 413 >gb|AJK30634.1| squalene synthase [Panax ginseng] Length = 415 Score = 98.2 bits (243), Expect = 2e-21 Identities = 51/65 (78%), Positives = 59/65 (90%), Gaps = 1/65 (1%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 408 Query: 241 N-LPN 230 N LPN Sbjct: 409 NLLPN 413 >gb|ABA29019.1| squalene synthase [Panax notoginseng] gb|AGS79226.1| squalene synthase [Panax notoginseng] Length = 415 Score = 98.2 bits (243), Expect = 2e-21 Identities = 51/65 (78%), Positives = 59/65 (90%), Gaps = 1/65 (1%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 408 Query: 241 N-LPN 230 N LPN Sbjct: 409 NLLPN 413 >gb|AIK21786.1| squalene synthase [Panax notoginseng] Length = 415 Score = 98.2 bits (243), Expect = 2e-21 Identities = 51/65 (78%), Positives = 59/65 (90%), Gaps = 1/65 (1%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 408 Query: 241 N-LPN 230 N LPN Sbjct: 409 NLLPN 413 >gb|AGI19256.1| squalene synthase [Panax notoginseng] Length = 415 Score = 98.2 bits (243), Expect = 2e-21 Identities = 51/65 (78%), Positives = 59/65 (90%), Gaps = 1/65 (1%) Frame = -2 Query: 421 DPNATKTLSRVEAIQKTCKDSGALTTKRKSYIVENESGYNSTLFVILFIMLAILYAYLSS 242 DPNATKTLSR+EAIQKTCK+SG L+ KRKSYI+E+ESG+NS L I+FI+LAILYAYLSS Sbjct: 350 DPNATKTLSRLEAIQKTCKESGTLS-KRKSYIIESESGHNSALIAIIFIILAILYAYLSS 408 Query: 241 N-LPN 230 N LPN Sbjct: 409 NLLPN 413