BLASTX nr result
ID: Acanthopanax23_contig00011693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00011693 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017222608.1| PREDICTED: serine/threonine protein phosphat... 61 3e-08 ref|XP_017243300.1| PREDICTED: serine/threonine protein phosphat... 57 1e-06 gb|KVI11624.1| Armadillo-type fold [Cynara cardunculus var. scol... 55 5e-06 >ref|XP_017222608.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' iota isoform-like [Daucus carota subsp. sativus] gb|KZM83836.1| hypothetical protein DCAR_028742 [Daucus carota subsp. sativus] Length = 499 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 5 AERRRLTWERLENAAGY-QPVANNISSIVESTLCVAAC 115 AERRR+TWERLENAA Y QPVAN++SSI+ES CV AC Sbjct: 462 AERRRMTWERLENAASYQQPVANDVSSIIESAPCVVAC 499 >ref|XP_017243300.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' iota isoform-like [Daucus carota subsp. sativus] gb|KZN03336.1| hypothetical protein DCAR_012092 [Daucus carota subsp. sativus] Length = 503 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +2 Query: 2 VAERRRLTWERLENAAGYQPVANNISSIVESTLCVAAC 115 V ERR+LTWERLEN AG QP ANNIS+ ES+ CV C Sbjct: 466 VTERRKLTWERLENDAGLQPAANNISTRAESSPCVVVC 503 >gb|KVI11624.1| Armadillo-type fold [Cynara cardunculus var. scolymus] Length = 527 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +2 Query: 2 VAERRRLTWERLENAAGYQPVANNISSIVESTLCVAAC 115 VAERRRLTWERLEN A +QPV N+S + E+ C+ +C Sbjct: 490 VAERRRLTWERLENIAAFQPVVGNVSILEETAPCIVSC 527