BLASTX nr result
ID: Acanthopanax23_contig00010547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00010547 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40780.3| unnamed protein product, partial [Vitis vinifera] 58 5e-07 ref|XP_003634336.3| PREDICTED: bZIP transcription factor 60 [Vit... 58 1e-06 >emb|CBI40780.3| unnamed protein product, partial [Vitis vinifera] Length = 192 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -2 Query: 534 NQNRGSLAPRKAGSKVFELWVFQSLLMGKRCKASRSRMKPSSLTPEVL 391 ++ + S+APR GSK+FELW+ QS + KRCKAS+++MKP SL VL Sbjct: 144 DKGQKSVAPRGPGSKIFELWLLQSYVKSKRCKASKTKMKPGSLAHGVL 191 >ref|XP_003634336.3| PREDICTED: bZIP transcription factor 60 [Vitis vinifera] Length = 322 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -2 Query: 534 NQNRGSLAPRKAGSKVFELWVFQSLLMGKRCKASRSRMKPSSLTPEVL 391 ++ + S+APR GSK+FELW+ QS + KRCKAS+++MKP SL VL Sbjct: 274 DKGQKSVAPRGPGSKIFELWLLQSYVKSKRCKASKTKMKPGSLAHGVL 321