BLASTX nr result
ID: Acanthopanax23_contig00010169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00010169 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017229550.1| PREDICTED: protein MEI2-like 5 [Daucus carot... 57 2e-06 >ref|XP_017229550.1| PREDICTED: protein MEI2-like 5 [Daucus carota subsp. sativus] Length = 858 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +3 Query: 3 SEGSEADDQLVQEPLPSNSLNIQTSHSKRPVLDSGDSPGSTTKDSAGEVSSLEK 164 +EG E DQ+ +EPL S SLN+Q + SK P DS + PGST KD A E S +EK Sbjct: 804 AEGPEVGDQVSEEPLTSGSLNVQIARSKLPGSDSREPPGSTAKDGAEESSFVEK 857