BLASTX nr result
ID: Acanthopanax23_contig00009735
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00009735 (1311 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN10149.1| hypothetical protein DCAR_002805 [Daucus carota s... 64 4e-07 ref|XP_017224679.1| PREDICTED: uncharacterized protein LOC108200... 64 4e-07 gb|ESR57499.1| hypothetical protein CICLE_v10018467mg [Citrus cl... 62 2e-06 ref|XP_024042772.1| uncharacterized protein LOC18049047 [Citrus ... 62 2e-06 ref|XP_006479897.1| PREDICTED: uncharacterized protein LOC102611... 62 2e-06 dbj|GAY40882.1| hypothetical protein CUMW_055260 [Citrus unshiu] 61 5e-06 gb|POF21650.1| hypothetical protein CFP56_24772 [Quercus suber] 54 5e-06 ref|XP_022862691.1| uncharacterized protein LOC111382889 [Olea e... 57 7e-06 ref|XP_022876569.1| uncharacterized protein LOC111394790 isoform... 60 8e-06 ref|XP_022876559.1| uncharacterized protein LOC111394790 isoform... 60 8e-06 ref|XP_022876551.1| uncharacterized protein LOC111394790 isoform... 60 8e-06 ref|XP_022876543.1| uncharacterized protein LOC111394790 isoform... 60 8e-06 >gb|KZN10149.1| hypothetical protein DCAR_002805 [Daucus carota subsp. sativus] Length = 1672 Score = 64.3 bits (155), Expect = 4e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+PSVK+ALDFNFQDVEG LRLVRLAMEAISR Sbjct: 1639 REGLPSVKKALDFNFQDVEGFLRLVRLAMEAISR 1672 >ref|XP_017224679.1| PREDICTED: uncharacterized protein LOC108200914 [Daucus carota subsp. sativus] ref|XP_017224686.1| PREDICTED: uncharacterized protein LOC108200914 [Daucus carota subsp. sativus] Length = 1688 Score = 64.3 bits (155), Expect = 4e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+PSVK+ALDFNFQDVEG LRLVRLAMEAISR Sbjct: 1655 REGLPSVKKALDFNFQDVEGFLRLVRLAMEAISR 1688 >gb|ESR57499.1| hypothetical protein CICLE_v10018467mg [Citrus clementina] Length = 1695 Score = 62.0 bits (149), Expect = 2e-06 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 +EG+ S+KRALDFNFQDVEGLLRLVRLAMEAISR Sbjct: 1662 KEGISSIKRALDFNFQDVEGLLRLVRLAMEAISR 1695 >ref|XP_024042772.1| uncharacterized protein LOC18049047 [Citrus clementina] ref|XP_024042773.1| uncharacterized protein LOC18049047 [Citrus clementina] Length = 1710 Score = 62.0 bits (149), Expect = 2e-06 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 +EG+ S+KRALDFNFQDVEGLLRLVRLAMEAISR Sbjct: 1677 KEGISSIKRALDFNFQDVEGLLRLVRLAMEAISR 1710 >ref|XP_006479897.1| PREDICTED: uncharacterized protein LOC102611579 [Citrus sinensis] gb|KDO87349.1| hypothetical protein CISIN_1g000296mg [Citrus sinensis] gb|KDO87350.1| hypothetical protein CISIN_1g000296mg [Citrus sinensis] Length = 1710 Score = 62.0 bits (149), Expect = 2e-06 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 +EG+ S+KRALDFNFQDVEGLLRLVRLAMEAISR Sbjct: 1677 KEGISSIKRALDFNFQDVEGLLRLVRLAMEAISR 1710 >dbj|GAY40882.1| hypothetical protein CUMW_055260 [Citrus unshiu] Length = 1710 Score = 60.8 bits (146), Expect = 5e-06 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 +EG+ S+KRALDFNFQDVEGLLRL+RLAMEAISR Sbjct: 1677 KEGISSIKRALDFNFQDVEGLLRLLRLAMEAISR 1710 >gb|POF21650.1| hypothetical protein CFP56_24772 [Quercus suber] Length = 66 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 1308 EGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 E + S+KRALDFNF DVEGLLRLV+LAME ISR Sbjct: 34 ESISSIKRALDFNFHDVEGLLRLVKLAMETISR 66 >ref|XP_022862691.1| uncharacterized protein LOC111382889 [Olea europaea var. sylvestris] Length = 181 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAIS 1213 REG+ SVK ALDFNFQDV+GLLRLVR+AMEAIS Sbjct: 148 REGISSVKMALDFNFQDVDGLLRLVRVAMEAIS 180 >ref|XP_022876569.1| uncharacterized protein LOC111394790 isoform X4 [Olea europaea var. sylvestris] Length = 1459 Score = 60.1 bits (144), Expect = 8e-06 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+ SVK+ALDFNFQDV+GLLRLVR+AMEAISR Sbjct: 1426 REGISSVKKALDFNFQDVDGLLRLVRVAMEAISR 1459 >ref|XP_022876559.1| uncharacterized protein LOC111394790 isoform X3 [Olea europaea var. sylvestris] Length = 1611 Score = 60.1 bits (144), Expect = 8e-06 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+ SVK+ALDFNFQDV+GLLRLVR+AMEAISR Sbjct: 1578 REGISSVKKALDFNFQDVDGLLRLVRVAMEAISR 1611 >ref|XP_022876551.1| uncharacterized protein LOC111394790 isoform X2 [Olea europaea var. sylvestris] Length = 1625 Score = 60.1 bits (144), Expect = 8e-06 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+ SVK+ALDFNFQDV+GLLRLVR+AMEAISR Sbjct: 1592 REGISSVKKALDFNFQDVDGLLRLVRVAMEAISR 1625 >ref|XP_022876543.1| uncharacterized protein LOC111394790 isoform X1 [Olea europaea var. sylvestris] Length = 1631 Score = 60.1 bits (144), Expect = 8e-06 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 1311 REGMPSVKRALDFNFQDVEGLLRLVRLAMEAISR 1210 REG+ SVK+ALDFNFQDV+GLLRLVR+AMEAISR Sbjct: 1598 REGISSVKKALDFNFQDVDGLLRLVRVAMEAISR 1631