BLASTX nr result
ID: Acanthopanax23_contig00009733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00009733 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550512.1| PREDICTED: two-component response regulator ... 75 4e-12 ref|XP_004508172.1| PREDICTED: two-component response regulator ... 74 7e-12 ref|XP_022874680.1| two-component response regulator ARR2-like i... 74 9e-12 gb|KYP57922.1| Two-component response regulator ARR2 [Cajanus ca... 73 1e-11 ref|XP_020226556.1| two-component response regulator ARR2-like i... 73 1e-11 ref|XP_009768392.1| PREDICTED: two-component response regulator ... 73 2e-11 gb|KHN02925.1| Two-component response regulator ARR2 [Glycine soja] 72 2e-11 ref|XP_003529546.1| PREDICTED: two-component response regulator ... 72 2e-11 ref|XP_015076165.1| PREDICTED: two-component response regulator ... 72 3e-11 ref|XP_006345976.1| PREDICTED: two-component response regulator ... 72 3e-11 gb|KDO71818.1| hypothetical protein CISIN_1g022984mg [Citrus sin... 70 5e-11 ref|XP_019177684.1| PREDICTED: two-component response regulator ... 71 6e-11 ref|XP_004239797.1| PREDICTED: two-component response regulator ... 71 8e-11 ref|XP_019425652.1| PREDICTED: two-component response regulator ... 71 8e-11 ref|XP_021806202.1| two-component response regulator ARR2-like i... 71 8e-11 ref|XP_016487452.1| PREDICTED: two-component response regulator ... 71 8e-11 ref|XP_009615647.1| PREDICTED: two-component response regulator ... 71 8e-11 ref|XP_021906935.1| two-component response regulator ARR2 isofor... 70 1e-10 ref|XP_021906934.1| two-component response regulator ARR2 isofor... 70 1e-10 ref|XP_016197834.1| two-component response regulator ARR1 [Arach... 70 1e-10 >ref|XP_003550512.1| PREDICTED: two-component response regulator ARR2 [Glycine max] gb|KHN03323.1| Two-component response regulator ARR2 [Glycine soja] gb|KRH02311.1| hypothetical protein GLYMA_17G030600 [Glycine max] Length = 677 Score = 74.7 bits (182), Expect = 4e-12 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLMT LLKQQEG+G ENEF FDGYSLDN+PV Sbjct: 632 SSQTNLFPEHYGQEDLMTALLKQQEGMGPAENEFEFDGYSLDNIPV 677 >ref|XP_004508172.1| PREDICTED: two-component response regulator ARR2 isoform X1 [Cicer arietinum] Length = 676 Score = 73.9 bits (180), Expect = 7e-12 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLM+ LLKQQEGIG ENEF FDGYSLDN+PV Sbjct: 631 SSQTNLFPEHYGQEDLMSALLKQQEGIGQAENEFDFDGYSLDNIPV 676 >ref|XP_022874680.1| two-component response regulator ARR2-like isoform X2 [Olea europaea var. sylvestris] Length = 678 Score = 73.6 bits (179), Expect = 9e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 6 YQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 +QNT PEQ+GQ+DLM+ LLKQQEG G +E+EF FDGY LDNLPV Sbjct: 634 FQNTFFPEQFGQDDLMSALLKQQEGTGAVESEFGFDGYHLDNLPV 678 >gb|KYP57922.1| Two-component response regulator ARR2 [Cajanus cajan] Length = 509 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLM+ LLKQQEG+G ENEF FDGYSLDN+PV Sbjct: 464 SSQTNLFPEHYGQEDLMSALLKQQEGMGPAENEFEFDGYSLDNIPV 509 >ref|XP_020226556.1| two-component response regulator ARR2-like isoform X1 [Cajanus cajan] Length = 682 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLM+ LLKQQEG+G ENEF FDGYSLDN+PV Sbjct: 637 SSQTNLFPEHYGQEDLMSALLKQQEGMGPAENEFEFDGYSLDNIPV 682 >ref|XP_009768392.1| PREDICTED: two-component response regulator ARR1-like [Nicotiana sylvestris] Length = 670 Score = 72.8 bits (177), Expect = 2e-11 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 SYQN P+Q+GQ+DLM+ LLKQQE +G +E+EF FDGY+LDNLPV Sbjct: 625 SYQNNFFPDQFGQDDLMSALLKQQESVGPVESEFGFDGYALDNLPV 670 >gb|KHN02925.1| Two-component response regulator ARR2 [Glycine soja] Length = 679 Score = 72.4 bits (176), Expect = 2e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLM+ LLKQQEG+G ENEF FDGYSLDN+PV Sbjct: 634 SSQTNLFPEHYGQEDLMSALLKQQEGMGPSENEFDFDGYSLDNIPV 679 >ref|XP_003529546.1| PREDICTED: two-component response regulator ARR2 [Glycine max] gb|KRH50777.1| hypothetical protein GLYMA_07G243300 [Glycine max] Length = 679 Score = 72.4 bits (176), Expect = 2e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q L PE YGQEDLM+ LLKQQEG+G ENEF FDGYSLDN+PV Sbjct: 634 SSQTNLFPEHYGQEDLMSALLKQQEGMGPSENEFDFDGYSLDNIPV 679 >ref|XP_015076165.1| PREDICTED: two-component response regulator ARR1-like [Solanum pennellii] Length = 663 Score = 72.0 bits (175), Expect = 3e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYS-LDNLPV 140 SYQNT PEQ+GQ+DLM+ LLKQQE +G +E EF FDGYS LDNLPV Sbjct: 617 SYQNTFFPEQFGQDDLMSALLKQQESVGQVETEFGFDGYSPLDNLPV 663 >ref|XP_006345976.1| PREDICTED: two-component response regulator ARR1-like [Solanum tuberosum] Length = 663 Score = 72.0 bits (175), Expect = 3e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYS-LDNLPV 140 SYQNT PEQ+GQ+DLM+ LLKQQE +G +E EF FDGYS LDNLPV Sbjct: 617 SYQNTFFPEQFGQDDLMSALLKQQESVGQVETEFGFDGYSPLDNLPV 663 >gb|KDO71818.1| hypothetical protein CISIN_1g022984mg [Citrus sinensis] Length = 288 Score = 70.5 bits (171), Expect = 5e-11 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q TLLP+ +GQEDLM+ +LKQQ+G+G EN+F FDGYSLDN+PV Sbjct: 243 SCQPTLLPQHFGQEDLMSAILKQQDGLGPAENDFEFDGYSLDNIPV 288 >ref|XP_019177684.1| PREDICTED: two-component response regulator ARR2-like [Ipomoea nil] ref|XP_019177685.1| PREDICTED: two-component response regulator ARR2-like [Ipomoea nil] ref|XP_019177686.1| PREDICTED: two-component response regulator ARR2-like [Ipomoea nil] Length = 650 Score = 71.2 bits (173), Expect = 6e-11 Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 SYQNTLLP-EQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 SYQNTL P +Q+GQ+DLM+ LLKQQE +G +ENEF FDGY L NLPV Sbjct: 604 SYQNTLFPVDQHGQDDLMSALLKQQESVGAVENEFSFDGYQLGNLPV 650 >ref|XP_004239797.1| PREDICTED: two-component response regulator ARR1 isoform X1 [Solanum lycopersicum] ref|XP_019069410.1| PREDICTED: two-component response regulator ARR1 isoform X2 [Solanum lycopersicum] Length = 663 Score = 70.9 bits (172), Expect = 8e-11 Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYS-LDNLPV 140 +YQNT PEQ+GQ+DLM+ LLKQQE +G +E EF FDGYS LDNLPV Sbjct: 617 TYQNTFFPEQFGQDDLMSALLKQQESVGQVETEFGFDGYSPLDNLPV 663 >ref|XP_019425652.1| PREDICTED: two-component response regulator ARR2-like isoform X2 [Lupinus angustifolius] gb|OIV91680.1| hypothetical protein TanjilG_26533 [Lupinus angustifolius] Length = 668 Score = 70.9 bits (172), Expect = 8e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 9 QNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 Q L P+QYGQEDLM+ LLKQQ GIG ENEF FDGYSLDN+PV Sbjct: 625 QINLFPDQYGQEDLMSALLKQQGGIGSAENEFDFDGYSLDNIPV 668 >ref|XP_021806202.1| two-component response regulator ARR2-like isoform X2 [Prunus avium] Length = 675 Score = 70.9 bits (172), Expect = 8e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q + EQ+GQEDLM+ LLKQQEGIG ENEF FDGYSLDN+PV Sbjct: 630 SSQTSFFQEQFGQEDLMSALLKQQEGIGATENEFDFDGYSLDNIPV 675 >ref|XP_016487452.1| PREDICTED: two-component response regulator ARR2-like [Nicotiana tabacum] Length = 678 Score = 70.9 bits (172), Expect = 8e-11 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 SYQ++ P+Q+GQ+DLM+ LLKQQE +G +E EF FDGY+LDNLPV Sbjct: 633 SYQSSFFPDQFGQDDLMSALLKQQESVGPVETEFGFDGYALDNLPV 678 >ref|XP_009615647.1| PREDICTED: two-component response regulator ARR2-like [Nicotiana tomentosiformis] Length = 678 Score = 70.9 bits (172), Expect = 8e-11 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 SYQ++ P+Q+GQ+DLM+ LLKQQE +G +E EF FDGY+LDNLPV Sbjct: 633 SYQSSFFPDQFGQDDLMSALLKQQESVGPVETEFGFDGYALDNLPV 678 >ref|XP_021906935.1| two-component response regulator ARR2 isoform X2 [Carica papaya] Length = 570 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 12 NTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 ++L P+Q+GQEDLM+ LLKQQEGIG ENEF FDGYS+DN+PV Sbjct: 528 SSLFPDQFGQEDLMSALLKQQEGIGPAENEFDFDGYSMDNIPV 570 >ref|XP_021906934.1| two-component response regulator ARR2 isoform X1 [Carica papaya] Length = 614 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 12 NTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 ++L P+Q+GQEDLM+ LLKQQEGIG ENEF FDGYS+DN+PV Sbjct: 572 SSLFPDQFGQEDLMSALLKQQEGIGPAENEFDFDGYSMDNIPV 614 >ref|XP_016197834.1| two-component response regulator ARR1 [Arachis ipaensis] Length = 678 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +3 Query: 3 SYQNTLLPEQYGQEDLMTVLLKQQEGIGGIENEFVFDGYSLDNLPV 140 S Q PE YGQEDLM+ LLKQQEGIG EN+F FDGYSLDN+PV Sbjct: 633 SSQTNFYPEHYGQEDLMSALLKQQEGIGPAENDFDFDGYSLDNVPV 678