BLASTX nr result
ID: Acanthopanax23_contig00009714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00009714 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG09683.1| putative EXS [Helianthus annuus] 135 2e-37 ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing pro... 141 3e-37 gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] 141 4e-37 ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing pro... 141 5e-37 ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing pro... 141 5e-37 ref|XP_018805776.1| PREDICTED: xenotropic and polytropic retrovi... 135 6e-37 ref|XP_021984672.1| SPX and EXS domain-containing protein 5-like... 135 6e-37 ref|XP_019079382.1| PREDICTED: SPX and EXS domain-containing pro... 140 9e-37 gb|PON93278.1| EXS, C-terminal [Trema orientalis] 139 1e-36 gb|PON68780.1| EXS, C-terminal [Parasponia andersonii] 139 1e-36 ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing pro... 140 2e-36 ref|XP_022967791.1| SPX and EXS domain-containing protein 1-like... 138 3e-36 ref|XP_022894587.1| SPX and EXS domain-containing protein 5-like... 137 6e-36 ref|XP_022894586.1| SPX and EXS domain-containing protein 5-like... 137 6e-36 ref|XP_022967789.1| SPX and EXS domain-containing protein 1-like... 138 7e-36 ref|XP_023544393.1| SPX and EXS domain-containing protein 1-like... 137 1e-35 ref|XP_022932883.1| SPX and EXS domain-containing protein 1 isof... 137 1e-35 gb|PNX80060.1| SPX and EXS domain-containing protein 1-like, par... 130 1e-35 ref|XP_022894584.1| SPX and EXS domain-containing protein 3-like... 137 1e-35 ref|XP_022894583.1| SPX and EXS domain-containing protein 5-like... 137 2e-35 >gb|OTG09683.1| putative EXS [Helianthus annuus] Length = 165 Score = 135 bits (339), Expect = 2e-37 Identities = 62/76 (81%), Positives = 67/76 (88%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVF ITALEIFRRFQW FFRVENEWNKMNSKQN+Q Sbjct: 90 SNLILRCTWTYKLSAHLRHNYLTVFAITALEIFRRFQWAFFRVENEWNKMNSKQNVQMQD 149 Query: 284 PDSEEDQLLNSSDHNV 237 EE++LLN ++HNV Sbjct: 150 ISGEEEKLLNLNNHNV 165 >ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Cucumis melo] Length = 430 Score = 141 bits (356), Expect = 3e-37 Identities = 67/78 (85%), Positives = 73/78 (93%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ +M Sbjct: 353 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 412 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+HNV Sbjct: 413 SNLPTEEDKLLNSSNHNV 430 >gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] Length = 456 Score = 141 bits (356), Expect = 4e-37 Identities = 67/78 (85%), Positives = 73/78 (93%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ +M Sbjct: 379 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 438 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+HNV Sbjct: 439 SNLPTEEDKLLNSSNHNV 456 >ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] ref|XP_008455705.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] Length = 477 Score = 141 bits (356), Expect = 5e-37 Identities = 67/78 (85%), Positives = 73/78 (93%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ +M Sbjct: 400 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 459 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+HNV Sbjct: 460 SNLPTEEDKLLNSSNHNV 477 >ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] Length = 477 Score = 141 bits (356), Expect = 5e-37 Identities = 67/78 (85%), Positives = 73/78 (93%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ +M Sbjct: 400 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 459 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+HNV Sbjct: 460 SNLPTEEDKLLNSSNHNV 477 >ref|XP_018805776.1| PREDICTED: xenotropic and polytropic retrovirus receptor 1 homolog, partial [Juglans regia] Length = 217 Score = 135 bits (340), Expect = 6e-37 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 3/79 (3%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNL+LRCTWTYKLSAHLRHNYLTVF I ALEIFRRFQW+FFRVENEWNKMNSK NIQ SM Sbjct: 139 SNLVLRCTWTYKLSAHLRHNYLTVFAIAALEIFRRFQWIFFRVENEWNKMNSKSNIQLSM 198 Query: 284 ---PDSEEDQLLNSSDHNV 237 P+ EE +LL SS+HNV Sbjct: 199 NDIPNEEEKKLLASSEHNV 217 >ref|XP_021984672.1| SPX and EXS domain-containing protein 5-like [Helianthus annuus] Length = 207 Score = 135 bits (339), Expect = 6e-37 Identities = 62/76 (81%), Positives = 67/76 (88%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVF ITALEIFRRFQW FFRVENEWNKMNSKQN+Q Sbjct: 132 SNLILRCTWTYKLSAHLRHNYLTVFAITALEIFRRFQWAFFRVENEWNKMNSKQNVQMQD 191 Query: 284 PDSEEDQLLNSSDHNV 237 EE++LLN ++HNV Sbjct: 192 ISGEEEKLLNLNNHNV 207 >ref|XP_019079382.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Vitis vinifera] Length = 424 Score = 140 bits (352), Expect = 9e-37 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNL+LRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSK NIQ SM Sbjct: 348 SNLVLRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 407 Query: 284 PD-SEEDQLLNSSDHNV 237 D SEED+LL S++ NV Sbjct: 408 SDTSEEDKLLGSNERNV 424 >gb|PON93278.1| EXS, C-terminal [Trema orientalis] Length = 389 Score = 139 bits (349), Expect = 1e-36 Identities = 67/78 (85%), Positives = 72/78 (92%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSK NIQ SM Sbjct: 312 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 371 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LL S++HNV Sbjct: 372 NEIPTEEDKLLASNNHNV 389 >gb|PON68780.1| EXS, C-terminal [Parasponia andersonii] Length = 390 Score = 139 bits (349), Expect = 1e-36 Identities = 67/78 (85%), Positives = 72/78 (92%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSK NIQ SM Sbjct: 313 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 372 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LL S++HNV Sbjct: 373 NEIPTEEDKLLASNNHNV 390 >ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Vitis vinifera] emb|CBI28965.3| unnamed protein product, partial [Vitis vinifera] Length = 472 Score = 140 bits (352), Expect = 2e-36 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNL+LRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSK NIQ SM Sbjct: 396 SNLVLRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 455 Query: 284 PD-SEEDQLLNSSDHNV 237 D SEED+LL S++ NV Sbjct: 456 SDTSEEDKLLGSNERNV 472 >ref|XP_022967791.1| SPX and EXS domain-containing protein 1-like isoform X2 [Cucurbita maxima] Length = 417 Score = 138 bits (348), Expect = 3e-36 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQF-S 288 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ S Sbjct: 341 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKTNIQITS 400 Query: 287 MPDSEEDQLLNSSDHNV 237 +EED+LLNSS+HNV Sbjct: 401 NLPTEEDKLLNSSNHNV 417 >ref|XP_022894587.1| SPX and EXS domain-containing protein 5-like isoform X6 [Olea europaea var. sylvestris] Length = 399 Score = 137 bits (345), Expect = 6e-36 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTIT LE+ RRFQWVFFRVENEWNK+NSK NIQ SM Sbjct: 322 SNLILRCTWTYKLSAHLRHNYLTVFTITVLEMLRRFQWVFFRVENEWNKINSKSNIQLSM 381 Query: 284 PD--SEEDQLLNSSDHNV 237 D +EED+LL+S+DHNV Sbjct: 382 TDTSNEEDKLLSSNDHNV 399 >ref|XP_022894586.1| SPX and EXS domain-containing protein 5-like isoform X5 [Olea europaea var. sylvestris] Length = 401 Score = 137 bits (345), Expect = 6e-36 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTIT LE+ RRFQWVFFRVENEWNK+NSK NIQ SM Sbjct: 324 SNLILRCTWTYKLSAHLRHNYLTVFTITVLEMLRRFQWVFFRVENEWNKINSKSNIQLSM 383 Query: 284 PD--SEEDQLLNSSDHNV 237 D +EED+LL+S+DHNV Sbjct: 384 TDTSNEEDKLLSSNDHNV 401 >ref|XP_022967789.1| SPX and EXS domain-containing protein 1-like isoform X1 [Cucurbita maxima] ref|XP_022967790.1| SPX and EXS domain-containing protein 1-like isoform X1 [Cucurbita maxima] Length = 475 Score = 138 bits (348), Expect = 7e-36 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQF-S 288 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ S Sbjct: 399 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKTNIQITS 458 Query: 287 MPDSEEDQLLNSSDHNV 237 +EED+LLNSS+HNV Sbjct: 459 NLPTEEDKLLNSSNHNV 475 >ref|XP_023544393.1| SPX and EXS domain-containing protein 1-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 418 Score = 137 bits (344), Expect = 1e-35 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ + Sbjct: 341 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKTNIQITS 400 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+H+V Sbjct: 401 SNLPTEEDKLLNSSNHSV 418 >ref|XP_022932883.1| SPX and EXS domain-containing protein 1 isoform X2 [Cucurbita moschata] Length = 418 Score = 137 bits (344), Expect = 1e-35 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQW+FFRVENEWNKMNSK NIQ + Sbjct: 341 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKTNIQITS 400 Query: 284 PD--SEEDQLLNSSDHNV 237 + +EED+LLNSS+H+V Sbjct: 401 SNLPTEEDKLLNSSNHSV 418 >gb|PNX80060.1| SPX and EXS domain-containing protein 1-like, partial [Trifolium pratense] Length = 155 Score = 130 bits (326), Expect = 1e-35 Identities = 58/76 (76%), Positives = 69/76 (90%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNL+LRCTWTYKLSAHLRHNYLTVFTI ALEIFRRFQW+FFRVENEWNKMN+K ++Q S Sbjct: 80 SNLVLRCTWTYKLSAHLRHNYLTVFTIAALEIFRRFQWIFFRVENEWNKMNNKSHMQMSE 139 Query: 284 PDSEEDQLLNSSDHNV 237 +EE++LL+S ++NV Sbjct: 140 MSNEEEKLLHSMNYNV 155 >ref|XP_022894584.1| SPX and EXS domain-containing protein 3-like isoform X3 [Olea europaea var. sylvestris] Length = 445 Score = 137 bits (345), Expect = 1e-35 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTIT LE+ RRFQWVFFRVENEWNK+NSK NIQ SM Sbjct: 368 SNLILRCTWTYKLSAHLRHNYLTVFTITVLEMLRRFQWVFFRVENEWNKINSKSNIQLSM 427 Query: 284 PD--SEEDQLLNSSDHNV 237 D +EED+LL+S+DHNV Sbjct: 428 TDTSNEEDKLLSSNDHNV 445 >ref|XP_022894583.1| SPX and EXS domain-containing protein 5-like isoform X2 [Olea europaea var. sylvestris] Length = 482 Score = 137 bits (345), Expect = 2e-35 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 2/78 (2%) Frame = -1 Query: 464 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKQNIQFSM 285 SNLILRCTWTYKLSAHLRHNYLTVFTIT LE+ RRFQWVFFRVENEWNK+NSK NIQ SM Sbjct: 405 SNLILRCTWTYKLSAHLRHNYLTVFTITVLEMLRRFQWVFFRVENEWNKINSKSNIQLSM 464 Query: 284 PD--SEEDQLLNSSDHNV 237 D +EED+LL+S+DHNV Sbjct: 465 TDTSNEEDKLLSSNDHNV 482