BLASTX nr result
ID: Acanthopanax23_contig00009680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00009680 (861 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019172626.1| PREDICTED: SNARE-interacting protein KEULE-l... 51 2e-08 ref|XP_016444225.1| PREDICTED: SNARE-interacting protein KEULE-l... 51 3e-08 ref|XP_009599695.1| PREDICTED: SNARE-interacting protein KEULE [... 51 3e-08 ref|XP_012087094.1| SNARE-interacting protein KEULE [Jatropha cu... 50 5e-08 gb|OIS99594.1| snare-interacting protein keule, partial [Nicotia... 49 5e-08 gb|PNT45052.1| hypothetical protein POPTR_003G115800v3 [Populus ... 47 7e-08 ref|XP_011033888.1| PREDICTED: SNARE-interacting protein KEULE-l... 47 7e-08 gb|PNT45053.1| hypothetical protein POPTR_003G115800v3 [Populus ... 47 7e-08 gb|PNT45051.1| hypothetical protein POPTR_003G115800v3 [Populus ... 47 7e-08 ref|XP_002303535.2| KEULE family protein [Populus trichocarpa] 47 9e-08 gb|PHU28397.1| putative protein transport Sec1a [Capsicum chinense] 49 9e-08 gb|PHT58025.1| putative protein transport Sec1a [Capsicum baccatum] 49 9e-08 ref|XP_016568059.1| PREDICTED: SNARE-interacting protein KEULE [... 49 9e-08 ref|XP_021635473.1| SNARE-interacting protein KEULE-like [Hevea ... 49 9e-08 ref|XP_009764741.1| PREDICTED: SNARE-interacting protein KEULE i... 49 1e-07 ref|XP_019252325.1| PREDICTED: SNARE-interacting protein KEULE i... 49 1e-07 ref|XP_016486195.1| PREDICTED: SNARE-interacting protein KEULE-l... 49 1e-07 ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-l... 49 1e-07 ref|XP_016486196.1| PREDICTED: SNARE-interacting protein KEULE-l... 49 1e-07 ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE i... 49 1e-07 >ref|XP_019172626.1| PREDICTED: SNARE-interacting protein KEULE-like, partial [Ipomoea nil] Length = 227 Score = 50.8 bits (120), Expect(2) = 2e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+N+I RDTS LSRIGALR Sbjct: 117 FVFFSSPITKELVNHIKRDTSVLSRIGALR 146 Score = 37.0 bits (84), Expect(2) = 2e-08 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLYKK + SS Sbjct: 98 NVVMFLSDMAGKSPLYKKAFVFFSS 122 >ref|XP_016444225.1| PREDICTED: SNARE-interacting protein KEULE-like [Nicotiana tabacum] Length = 666 Score = 51.2 bits (121), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+NYI RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNYIKRDSSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVVMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_009599695.1| PREDICTED: SNARE-interacting protein KEULE [Nicotiana tomentosiformis] Length = 666 Score = 51.2 bits (121), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+NYI RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNYIKRDSSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVVMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_012087094.1| SNARE-interacting protein KEULE [Jatropha curcas] gb|KDP25591.1| hypothetical protein JCGZ_20747 [Jatropha curcas] Length = 664 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 +VFFSSPISREL+ YI +DTS LSRIGALR Sbjct: 117 YVFFSSPISRELVTYIKKDTSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 5e-08 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD++GK+PLYKK + SS +S Sbjct: 98 NVVMFLSDMSGKAPLYKKAYVFFSSPIS 125 >gb|OIS99594.1| snare-interacting protein keule, partial [Nicotiana attenuata] Length = 569 Score = 49.3 bits (116), Expect(2) = 5e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 20 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 49 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 SV MFLSD+AGKSPLY+K + SS Sbjct: 1 SVVMFLSDMAGKSPLYRKAFVFFSS 25 >gb|PNT45052.1| hypothetical protein POPTR_003G115800v3 [Populus trichocarpa] gb|PNT45054.1| hypothetical protein POPTR_003G115800v3 [Populus trichocarpa] Length = 666 Score = 47.4 bits (111), Expect(2) = 7e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+++I +D+S L+RIGALR Sbjct: 118 FVFFSSPISRELVSHIKKDSSVLTRIGALR 147 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD+AGKSPLYKK + SS +S Sbjct: 99 NVIMFLSDMAGKSPLYKKAFVFFSSPIS 126 >ref|XP_011033888.1| PREDICTED: SNARE-interacting protein KEULE-like [Populus euphratica] ref|XP_011033889.1| PREDICTED: SNARE-interacting protein KEULE-like [Populus euphratica] Length = 666 Score = 47.4 bits (111), Expect(2) = 7e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+++I +D+S L+RIGALR Sbjct: 118 FVFFSSPISRELVSHIKKDSSVLTRIGALR 147 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD+AGKSPLYKK + SS +S Sbjct: 99 NVIMFLSDMAGKSPLYKKAFVFFSSPIS 126 >gb|PNT45053.1| hypothetical protein POPTR_003G115800v3 [Populus trichocarpa] Length = 658 Score = 47.4 bits (111), Expect(2) = 7e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+++I +D+S L+RIGALR Sbjct: 118 FVFFSSPISRELVSHIKKDSSVLTRIGALR 147 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD+AGKSPLYKK + SS +S Sbjct: 99 NVIMFLSDMAGKSPLYKKAFVFFSSPIS 126 >gb|PNT45051.1| hypothetical protein POPTR_003G115800v3 [Populus trichocarpa] Length = 589 Score = 47.4 bits (111), Expect(2) = 7e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+++I +D+S L+RIGALR Sbjct: 118 FVFFSSPISRELVSHIKKDSSVLTRIGALR 147 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD+AGKSPLYKK + SS +S Sbjct: 99 NVIMFLSDMAGKSPLYKKAFVFFSSPIS 126 >ref|XP_002303535.2| KEULE family protein [Populus trichocarpa] Length = 673 Score = 47.4 bits (111), Expect(2) = 9e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+++I +D+S L+RIGALR Sbjct: 125 FVFFSSPISRELVSHIKKDSSVLTRIGALR 154 Score = 38.1 bits (87), Expect(2) = 9e-08 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 265 VFMFLSDIAGKSPLYKKCVNYLSSILS 185 V MFLSD+AGKSPLYKK + SS +S Sbjct: 107 VIMFLSDMAGKSPLYKKAFVFFSSPIS 133 >gb|PHU28397.1| putative protein transport Sec1a [Capsicum chinense] Length = 666 Score = 49.3 bits (116), Expect(2) = 9e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+N+I RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNHIKRDSSVLSRIGALR 146 Score = 36.2 bits (82), Expect(2) = 9e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVLMFLSDMAGKSPLYRKAFVFFSS 122 >gb|PHT58025.1| putative protein transport Sec1a [Capsicum baccatum] Length = 666 Score = 49.3 bits (116), Expect(2) = 9e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+N+I RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNHIKRDSSVLSRIGALR 146 Score = 36.2 bits (82), Expect(2) = 9e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVLMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_016568059.1| PREDICTED: SNARE-interacting protein KEULE [Capsicum annuum] gb|PHT92601.1| putative protein transport Sec1a [Capsicum annuum] Length = 666 Score = 49.3 bits (116), Expect(2) = 9e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+N+I RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNHIKRDSSVLSRIGALR 146 Score = 36.2 bits (82), Expect(2) = 9e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVLMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_021635473.1| SNARE-interacting protein KEULE-like [Hevea brasiliensis] Length = 664 Score = 48.5 bits (114), Expect(2) = 9e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPISREL+ YI +DT LSRIGALR Sbjct: 117 FVFFSSPISRELVAYIKKDTVVLSRIGALR 146 Score = 37.0 bits (84), Expect(2) = 9e-08 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSSILS 185 +V MFLSD++GKSPLYKK + SS +S Sbjct: 98 NVVMFLSDMSGKSPLYKKAFVFFSSPIS 125 >ref|XP_009764741.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Nicotiana sylvestris] ref|XP_009764742.1| PREDICTED: SNARE-interacting protein KEULE isoform X2 [Nicotiana sylvestris] Length = 691 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 142 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 171 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 123 NVVMFLSDMAGKSPLYRKAFVFFSS 147 >ref|XP_019252325.1| PREDICTED: SNARE-interacting protein KEULE isoform X2 [Nicotiana attenuata] Length = 666 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVVMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_016486195.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Nicotiana tabacum] Length = 666 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVVMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-like [Solanum tuberosum] Length = 666 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL+N+I RD+S LSRIGALR Sbjct: 117 FVFFSSPIAKELVNHIKRDSSVLSRIGALR 146 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 98 NVVMFLSDMAGKSPLYRKAFVFFSS 122 >ref|XP_016486196.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Nicotiana tabacum] Length = 581 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 32 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 61 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 13 NVVMFLSDMAGKSPLYRKAFVFFSS 37 >ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE isoform X3 [Nicotiana sylvestris] Length = 581 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 111 FVFFSSPISRELINYI*RDTSALSRIGALR 22 FVFFSSPI++EL++YI RD+S LSRIGALR Sbjct: 32 FVFFSSPIAKELVSYIKRDSSVLSRIGALR 61 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 268 SVFMFLSDIAGKSPLYKKCVNYLSS 194 +V MFLSD+AGKSPLY+K + SS Sbjct: 13 NVVMFLSDMAGKSPLYRKAFVFFSS 37