BLASTX nr result
ID: Acanthopanax23_contig00009662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00009662 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368752.1| hypothetical protein POPTR_0001s09270g [Popu... 102 2e-24 gb|AKJ66815.1| glutathione peroxidase [Populus euphratica] 102 3e-24 ref|XP_002299536.1| glutathione peroxidase family protein [Popul... 102 3e-24 gb|PNT53810.1| hypothetical protein POPTR_001G105200v3 [Populus ... 100 5e-24 gb|PNT53809.1| hypothetical protein POPTR_001G105200v3 [Populus ... 100 7e-24 gb|APZ73851.1| glutathione peroxidase [Populus euphratica] >gi|1... 100 7e-24 emb|CBI34679.3| unnamed protein product, partial [Vitis vinifera] 100 7e-24 ref|XP_019156355.1| PREDICTED: probable phospholipid hydroperoxi... 100 7e-24 ref|XP_010529569.1| PREDICTED: probable phospholipid hydroperoxi... 102 7e-24 ref|XP_020675115.1| probable phospholipid hydroperoxide glutathi... 100 8e-24 ref|NP_001280872.1| probable phospholipid hydroperoxide glutathi... 100 1e-23 ref|XP_011029376.1| PREDICTED: LOW QUALITY PROTEIN: probable pho... 102 1e-23 gb|POE92747.1| putative phospholipid hydroperoxide glutathione p... 98 1e-23 gb|ACG39625.1| phospholipid hydroperoxide glutathione peroxidase... 100 1e-23 ref|XP_017236726.1| PREDICTED: probable phospholipid hydroperoxi... 100 1e-23 gb|AGT80153.1| glutathione peroxidase [Ipomoea trifida] 100 1e-23 gb|AFY26874.1| glutathione peroxidase [Ipomoea batatas] 100 1e-23 gb|KNA06117.1| hypothetical protein SOVF_184030 [Spinacia oleracea] 99 1e-23 gb|ABQ96599.1| glutathione peroxidase, partial [Ricinus communis] 100 2e-23 gb|AAL55674.1| glutathione peroxidase [Hevea brasiliensis] 100 2e-23 >ref|XP_006368752.1| hypothetical protein POPTR_0001s09270g [Populus trichocarpa] Length = 155 Score = 102 bits (253), Expect = 2e-24 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 89 KVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 139 >gb|AKJ66815.1| glutathione peroxidase [Populus euphratica] Length = 168 Score = 102 bits (253), Expect = 3e-24 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 102 KVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 152 >ref|XP_002299536.1| glutathione peroxidase family protein [Populus trichocarpa] gb|ABK96047.1| unknown [Populus trichocarpa] Length = 168 Score = 102 bits (253), Expect = 3e-24 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 102 KVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 152 >gb|PNT53810.1| hypothetical protein POPTR_001G105200v3 [Populus trichocarpa] Length = 155 Score = 100 bits (250), Expect = 5e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKS+KGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 89 KVDVNGKNAAPIYKFLKSNKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 139 >gb|PNT53809.1| hypothetical protein POPTR_001G105200v3 [Populus trichocarpa] Length = 168 Score = 100 bits (250), Expect = 7e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKS+KGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 102 KVDVNGKNAAPIYKFLKSNKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 152 >gb|APZ73851.1| glutathione peroxidase [Populus euphratica] gb|APZ73852.1| glutathione peroxidase [Populus euphratica] gb|APZ73853.1| glutathione peroxidase [Populus euphratica] gb|APZ73854.1| glutathione peroxidase [Populus euphratica] gb|APZ73855.1| glutathione peroxidase [Populus euphratica] gb|APZ73856.1| glutathione peroxidase [Populus euphratica] gb|APZ73857.1| glutathione peroxidase [Populus euphratica] gb|APZ73858.1| glutathione peroxidase [Populus euphratica] gb|APZ73859.1| glutathione peroxidase [Populus euphratica] gb|APZ73860.1| glutathione peroxidase [Populus euphratica] gb|APZ73861.1| glutathione peroxidase [Populus euphratica] gb|APZ73862.1| glutathione peroxidase [Populus euphratica] gb|APZ73863.1| glutathione peroxidase [Populus euphratica] gb|APZ73864.1| glutathione peroxidase [Populus euphratica] gb|APZ73865.1| glutathione peroxidase [Populus euphratica] gb|APZ73866.1| glutathione peroxidase [Populus euphratica] gb|APZ73867.1| glutathione peroxidase [Populus euphratica] gb|APZ73868.1| glutathione peroxidase [Populus euphratica] gb|APZ73869.1| glutathione peroxidase [Populus euphratica] gb|APZ73870.1| glutathione peroxidase [Populus euphratica] gb|APZ73871.1| glutathione peroxidase [Populus euphratica] gb|APZ73872.1| glutathione peroxidase [Populus euphratica] gb|APZ73873.1| glutathione peroxidase [Populus euphratica] gb|APZ73874.1| glutathione peroxidase [Populus euphratica] gb|APZ73875.1| glutathione peroxidase [Populus euphratica] gb|APZ73876.1| glutathione peroxidase [Populus euphratica] gb|APZ73877.1| glutathione peroxidase [Populus euphratica] gb|APZ73878.1| glutathione peroxidase [Populus euphratica] gb|APZ73879.1| glutathione peroxidase [Populus euphratica] gb|APZ73880.1| glutathione peroxidase [Populus euphratica] gb|APZ73881.1| glutathione peroxidase [Populus euphratica] gb|APZ73882.1| glutathione peroxidase [Populus euphratica] gb|APZ73883.1| glutathione peroxidase [Populus euphratica] gb|APZ73884.1| glutathione peroxidase [Populus euphratica] gb|APZ73885.1| glutathione peroxidase [Populus euphratica] gb|APZ73886.1| glutathione peroxidase [Populus euphratica] gb|APZ73887.1| glutathione peroxidase [Populus euphratica] gb|APZ73888.1| glutathione peroxidase [Populus euphratica] gb|APZ73889.1| glutathione peroxidase [Populus euphratica] gb|APZ73890.1| glutathione peroxidase [Populus euphratica] gb|APZ73891.1| glutathione peroxidase [Populus euphratica] gb|APZ73892.1| glutathione peroxidase [Populus euphratica] gb|APZ73893.1| glutathione peroxidase [Populus euphratica] gb|APZ73894.1| glutathione peroxidase [Populus euphratica] gb|APZ73895.1| glutathione peroxidase [Populus euphratica] gb|APZ73896.1| glutathione peroxidase [Populus euphratica] gb|APZ73897.1| glutathione peroxidase [Populus euphratica] gb|APZ73898.1| glutathione peroxidase [Populus euphratica] gb|APZ73899.1| glutathione peroxidase [Populus euphratica] gb|APZ73900.1| glutathione peroxidase [Populus euphratica] gb|APZ73901.1| glutathione peroxidase [Populus euphratica] gb|APZ73902.1| glutathione peroxidase [Populus euphratica] gb|APZ73903.1| glutathione peroxidase [Populus euphratica] gb|APZ73904.1| glutathione peroxidase [Populus euphratica] gb|APZ73905.1| glutathione peroxidase [Populus euphratica] gb|APZ73906.1| glutathione peroxidase [Populus euphratica] gb|APZ73907.1| glutathione peroxidase [Populus euphratica] gb|APZ73908.1| glutathione peroxidase [Populus euphratica] gb|APZ73909.1| glutathione peroxidase [Populus euphratica] gb|APZ73910.1| glutathione peroxidase [Populus euphratica] gb|APZ73911.1| glutathione peroxidase [Populus euphratica] gb|APZ73912.1| glutathione peroxidase [Populus euphratica] gb|APZ73913.1| glutathione peroxidase [Populus euphratica] gb|APZ73914.1| glutathione peroxidase [Populus euphratica] gb|APZ73915.1| glutathione peroxidase [Populus euphratica] gb|APZ73916.1| glutathione peroxidase [Populus euphratica] gb|APZ73917.1| glutathione peroxidase [Populus euphratica] gb|APZ73918.1| glutathione peroxidase [Populus euphratica] gb|APZ73919.1| glutathione peroxidase [Populus euphratica] gb|APZ73920.1| glutathione peroxidase [Populus euphratica] gb|APZ73921.1| glutathione peroxidase [Populus euphratica] gb|APZ73922.1| glutathione peroxidase [Populus euphratica] gb|APZ73923.1| glutathione peroxidase [Populus euphratica] gb|APZ73924.1| glutathione peroxidase [Populus euphratica] gb|APZ73925.1| glutathione peroxidase [Populus euphratica] gb|APZ73926.1| glutathione peroxidase [Populus euphratica] gb|APZ73927.1| glutathione peroxidase [Populus euphratica] gb|APZ73928.1| glutathione peroxidase [Populus euphratica] gb|APZ73929.1| glutathione peroxidase [Populus euphratica] gb|APZ73930.1| glutathione peroxidase [Populus euphratica] gb|APZ73931.1| glutathione peroxidase [Populus euphratica] gb|APZ73932.1| glutathione peroxidase [Populus euphratica] gb|APZ73933.1| glutathione peroxidase [Populus euphratica] gb|APZ73934.1| glutathione peroxidase [Populus euphratica] gb|APZ73935.1| glutathione peroxidase [Populus euphratica] gb|APZ73936.1| glutathione peroxidase [Populus euphratica] gb|APZ73937.1| glutathione peroxidase [Populus euphratica] gb|APZ73938.1| glutathione peroxidase [Populus euphratica] gb|APZ73939.1| glutathione peroxidase [Populus euphratica] gb|APZ73940.1| glutathione peroxidase [Populus euphratica] Length = 168 Score = 100 bits (250), Expect = 7e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +V+VNG NAAPIYK+LKSSKGGLFGDNIKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 102 KVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTT 152 >emb|CBI34679.3| unnamed protein product, partial [Vitis vinifera] Length = 168 Score = 100 bits (250), Expect = 7e-24 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 ++DVNG +AAP+YKFLKSSKGGLFGDNIKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 102 KIDVNGDSAAPLYKFLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTT 152 >ref|XP_019156355.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Ipomoea nil] Length = 169 Score = 100 bits (250), Expect = 7e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLK+SKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 103 KVDVNGSNAAPIYKFLKASKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 153 >ref|XP_010529569.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Tarenaya hassleriana] Length = 242 Score = 102 bits (255), Expect = 7e-24 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD IKWNFAKFLVDKDGKVVDRYAPTT Sbjct: 174 KVDVNGQNAAPIYKFLKSSKGGLFGDGIKWNFAKFLVDKDGKVVDRYAPTT 224 >ref|XP_020675115.1| probable phospholipid hydroperoxide glutathione peroxidase [Dendrobium catenatum] Length = 170 Score = 100 bits (250), Expect = 8e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDKDG+VVDRYAPTT Sbjct: 104 KVDVNGQNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGRVVDRYAPTT 154 >ref|NP_001280872.1| probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Malus domestica] gb|AAQ03092.1| glutathione peroxidase [Malus domestica] Length = 168 Score = 100 bits (249), Expect = 1e-23 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDK+GKVVDRYAPTT Sbjct: 102 KVDVNGDNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGKVVDRYAPTT 152 >ref|XP_011029376.1| PREDICTED: LOW QUALITY PROTEIN: probable phospholipid hydroperoxide glutathione peroxidase, partial [Populus euphratica] Length = 235 Score = 102 bits (253), Expect = 1e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 169 KVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 219 >gb|POE92747.1| putative phospholipid hydroperoxide glutathione peroxidase [Quercus suber] Length = 91 Score = 97.8 bits (242), Expect = 1e-23 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +2 Query: 335 IQVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 + VDVNG NAAP+YKFLKSSKGG+FGD+IKWNF+KFLVDKDG V+DRYAPTT Sbjct: 24 VLVDVNGNNAAPLYKFLKSSKGGIFGDSIKWNFSKFLVDKDGNVIDRYAPTT 75 >gb|ACG39625.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] Length = 168 Score = 100 bits (248), Expect = 1e-23 Identities = 51/77 (66%), Positives = 57/77 (74%), Gaps = 15/77 (19%) Frame = +2 Query: 305 GEEPIPNMLIIQ---------------VDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAK 439 G+EP N I+Q VDVNG NAAPIYKFLKSSKGGLFGD+IKWNF+K Sbjct: 76 GQEPGTNKEIVQFACTRFKAEYPIFDKVDVNGSNAAPIYKFLKSSKGGLFGDSIKWNFSK 135 Query: 440 FLVDKDGKVVDRYAPTT 490 FLVDK+G+VVDRYAPTT Sbjct: 136 FLVDKEGRVVDRYAPTT 152 >ref|XP_017236726.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Daucus carota subsp. sativus] gb|KZN05908.1| hypothetical protein DCAR_006745 [Daucus carota subsp. sativus] Length = 169 Score = 100 bits (248), Expect = 1e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 103 KVDVNGSNAAPVYKYLKSSKGGLFGDGIKWNFSKFLVDKDGKVVDRYAPTT 153 >gb|AGT80153.1| glutathione peroxidase [Ipomoea trifida] Length = 169 Score = 100 bits (248), Expect = 1e-23 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAP+YKFLK+SKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 103 KVDVNGSNAAPLYKFLKASKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 153 >gb|AFY26874.1| glutathione peroxidase [Ipomoea batatas] Length = 169 Score = 100 bits (248), Expect = 1e-23 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAP+YKFLK+SKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTT Sbjct: 103 KVDVNGSNAAPLYKFLKASKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTT 153 >gb|KNA06117.1| hypothetical protein SOVF_184030 [Spinacia oleracea] Length = 118 Score = 98.6 bits (244), Expect = 1e-23 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAPIYKFLKSSKGGLFGD +KWNF KFLVDKDG VVDRYAPTT Sbjct: 51 KVDVNGSNAAPIYKFLKSSKGGLFGDGLKWNFTKFLVDKDGNVVDRYAPTT 101 >gb|ABQ96599.1| glutathione peroxidase, partial [Ricinus communis] Length = 173 Score = 100 bits (248), Expect = 2e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAP+YKFLKSSKGG+FGDNIKWNF+KFLVDKDG VVDRYAPTT Sbjct: 99 KVDVNGNNAAPLYKFLKSSKGGIFGDNIKWNFSKFLVDKDGNVVDRYAPTT 149 >gb|AAL55674.1| glutathione peroxidase [Hevea brasiliensis] Length = 176 Score = 100 bits (248), Expect = 2e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 338 QVDVNGPNAAPIYKFLKSSKGGLFGDNIKWNFAKFLVDKDGKVVDRYAPTT 490 +VDVNG NAAP+YKFLKSSKGG+FGDNIKWNF+KFLVDKDG VVDRYAPTT Sbjct: 102 KVDVNGNNAAPLYKFLKSSKGGIFGDNIKWNFSKFLVDKDGNVVDRYAPTT 152