BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Acanthopanax23_contig00009543
         (1253 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AEW71649.1| 50S ribosomal protein L10 [Enterobacter cloacae E...   327   e-109
gb|AMO51105.1| 50S ribosomal protein L10 [Enterobacter sp. FY-07]     326   e-108
gb|EHB39666.1| ribosomal protein L10 [Salmonella enterica subsp....   324   e-108
ref|WP_001207201.1| MULTISPECIES: 50S ribosomal protein L10 [Pro...   311   e-103
ref|WP_032262442.1| 50S ribosomal protein L10 [Escherichia coli]...   311   e-103
ref|WP_103736552.1| 50S ribosomal protein L10 [Escherichia coli]      311   e-102
ref|WP_003923800.1| 50S ribosomal protein L10 [Escherichia coli]...   311   e-102
ref|WP_100039402.1| 50S ribosomal protein L10 [Escherichia coli]      310   e-102
ref|WP_089645762.1| 50S ribosomal protein L10 [Escherichia coli]      310   e-102
ref|WP_044808985.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_044067580.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_033547287.1| 50S ribosomal protein L10 [Escherichia coli]      310   e-102
ref|WP_023156879.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_098030698.1| 50S ribosomal protein L10 [Escherichia coli]      310   e-102
ref|WP_098704418.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_104457517.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_096261586.1| 50S ribosomal protein L10 [Escherichia coli]      310   e-102
ref|WP_069372217.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
ref|WP_064232206.1| 50S ribosomal protein L10 [Escherichia coli]...   310   e-102
emb|CDW59664.1| Ribosomal L10 domain containing protein [Trichur...   310   e-102

>gb|AEW71649.1| 50S ribosomal protein L10 [Enterobacter cloacae EcWSU1]
          Length = 176

 Score =  327 bits (839), Expect = e-109
 Identities = 172/174 (98%), Positives = 172/174 (98%)
 Frame = +2

Query: 284 SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY 463
           SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY
Sbjct: 3   SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY 62

Query: 464 MRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA 643
           MRVVRNTLLRR VEGTPFECLKD FVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA
Sbjct: 63  MRVVRNTLLRRVVEGTPFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA 122

Query: 644 AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 123 AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 176


>gb|AMO51105.1| 50S ribosomal protein L10 [Enterobacter sp. FY-07]
          Length = 176

 Score =  326 bits (835), Expect = e-108
 Identities = 172/173 (99%), Positives = 172/173 (99%)
 Frame = +2

Query: 287 GKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYM 466
           GKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYM
Sbjct: 4   GKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYM 63

Query: 467 RVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAA 646
           RVVRNTLLRRAVEGT FECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAA
Sbjct: 64  RVVRNTLLRRAVEGTAFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAA 123

Query: 647 FEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           FEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 124 FEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 176


>gb|EHB39666.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Infantis str. SARB27]
 gb|EMR51791.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Dublin str. UC16]
 gb|EPI70043.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 08-1080]
 gb|EPI74568.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Dublin str. DG22]
 gb|EPI74824.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2009K0958]
 gb|EPI81635.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2010K-0262]
 gb|EPI88256.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2009K1651]
 gb|EPI90214.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2009K1726]
 gb|EPI96579.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2010K-0267]
 gb|EPJ00005.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2010K-0284]
 gb|EPJ01447.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2010K-0271]
 gb|EPJ10193.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. 2010K-0286]
 gb|ETA88714.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Cubana str. 76814]
 gb|AIE08110.1| LSU ribosomal protein L10p (P0) [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gb|KWZ93331.1| ribosomal protein L10 [Citrobacter freundii]
          Length = 176

 Score =  324 bits (831), Expect = e-108
 Identities = 171/174 (98%), Positives = 171/174 (98%)
 Frame = +2

Query: 284 SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY 463
           SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY
Sbjct: 3   SGKHPGAKLMALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVY 62

Query: 464 MRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA 643
           MRVVRNTLLRR VEGT FECLKD FVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA
Sbjct: 63  MRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAA 122

Query: 644 AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 123 AFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 176


>ref|WP_001207201.1| MULTISPECIES: 50S ribosomal protein L10 [Proteobacteria]
 ref|NP_312935.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. Sakai]
 ref|NP_418412.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 ref|NP_709780.1| 50S ribosomal protein L10 [Shigella flexneri 2a str. 301]
 ref|YP_405189.1| 50S ribosomal protein L10 [Shigella dysenteriae Sd197]
 ref|YP_002410244.1| 50S ribosomal protein L10 [Escherichia coli IAI39]
 ref|YP_002415122.1| 50S ribosomal subunit protein L10 [Escherichia coli UMN026]
 ref|YP_006122320.1| 50S ribosomal protein L10 [Escherichia coli O83:H1 str. NRG 857C]
 ref|YP_006781436.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           2011C-3493]
 sp|P0A7J3.2|RL10_ECOLI RecName: Full=50S ribosomal protein L10; AltName: Full=50S
           ribosomal protein L8; AltName: Full=Large ribosomal
           subunit protein uL10
 sp|P0A7J4.2|RL10_ECOL6 RecName: Full=50S ribosomal protein L10
 sp|P0A7J5.2|RL10_ECO57 RecName: Full=50S ribosomal protein L10
 sp|P0A7J6.2|RL10_SHIFL RecName: Full=50S ribosomal protein L10
 sp|Q31U12.1|RL10_SHIBS RecName: Full=50S ribosomal protein L10
 sp|Q32AF7.1|RL10_SHIDS RecName: Full=50S ribosomal protein L10
 sp|Q3YUZ9.1|RL10_SHISS RecName: Full=50S ribosomal protein L10
 sp|Q1R5V0.1|RL10_ECOUT RecName: Full=50S ribosomal protein L10
 sp|Q0TA80.1|RL10_ECOL5 RecName: Full=50S ribosomal protein L10
 sp|Q0SY15.1|RL10_SHIF8 RecName: Full=50S ribosomal protein L10
 sp|A1AIF7.1|RL10_ECOK1 RecName: Full=50S ribosomal protein L10
 sp|A7ZUJ8.1|RL10_ECO24 RecName: Full=50S ribosomal protein L10
 sp|A8A784.1|RL10_ECOHS RecName: Full=50S ribosomal protein L10
 sp|B1IUR2.1|RL10_ECOLC RecName: Full=50S ribosomal protein L10
 sp|B7MIX1.1|RL10_ECO45 RecName: Full=50S ribosomal protein L10
 sp|B5Z081.1|RL10_ECO5E RecName: Full=50S ribosomal protein L10
 sp|B7NRR3.1|RL10_ECO7I RecName: Full=50S ribosomal protein L10
 sp|B7M732.1|RL10_ECO8A RecName: Full=50S ribosomal protein L10
 sp|B1XBY7.1|RL10_ECODH RecName: Full=50S ribosomal protein L10
 sp|B7NFS5.1|RL10_ECOLU RecName: Full=50S ribosomal protein L10
 sp|B6I5J5.1|RL10_ECOSE RecName: Full=50S ribosomal protein L10
 sp|B1LNT7.1|RL10_ECOSM RecName: Full=50S ribosomal protein L10
 sp|B7LUL7.1|RL10_ESCF3 RecName: Full=50S ribosomal protein L10
 sp|B2TWH1.1|RL10_SHIB3 RecName: Full=50S ribosomal protein L10
 sp|B7UPE0.1|RL10_ECO27 RecName: Full=50S ribosomal protein L10
 sp|B7LA78.1|RL10_ECO55 RecName: Full=50S ribosomal protein L10
 sp|B7MR71.1|RL10_ECO81 RecName: Full=50S ribosomal protein L10
 sp|C5A0S5.1|RL10_ECOBW RecName: Full=50S ribosomal protein L10
 pdb|3SGF|H Chain H, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOS|H Chain H, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|4KIX|5 Chain 5, Control Of Ribosomal Subunit Rotation By Elongation Factor
           G
 pdb|4KIZ|5 Chain 5, Control Of Ribosomal Subunit Rotation By Elongation Factor
           G
 pdb|4KJ1|5 Chain 5, Control Of Ribosomal Subunit Rotation By Elongation Factor
           G
 pdb|4KJ5|5 Chain 5, Control Of Ribosomal Subunit Rotation By Elongation Factor
           G
 pdb|4KJ9|5 Chain 5, Control Of Ribosomal Subunit Rotation By Elongation Factor
           G
 pdb|3J5O|5 Chain 5, Visualization Of Two Trnas Trapped In Transit During
           Ef-g-mediated Translocation (50s Subunit)
 pdb|3J5U|J Chain J, Structure Of The Ribosome With Elongation Factor G Trapped
           In The Pre- Translocation State (pre-translocation
           70s*trna Structure, 50s Subunit)
 pdb|3J5W|J Chain J, Structure Of The Ribosome With Elongation Factor G Trapped
           In The Pre- Translocation State (pre-translocation
           70s*trna*ef-g Structure, 50s Subunit)
 pdb|3J7Z|5 Chain 5, Structure Of The E. Coli 50s Subunit With Ermcl Nascent
           Chain
 pdb|5ADY|7 Chain 7, Cryo-em Structures Of The 50s Ribosome Subunit Bound With
           Hflx
 pdb|5IQR|H Chain H, Structure of RelA bound to the 70S ribosome
 pdb|5AFI|5 Chain 5, 2.9A Structure of E. coli ribosome-EF-TU complex by
           cs-corrected cryo-EM
 gb|AAG59181.1|AE005630_1 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           EDL933]
 gb|AAN83369.1|AE016770_169 50S ribosomal protein L10 [Escherichia coli CFT073]
 emb|CAA23623.1| rplJ (L10) [Escherichia coli]
 gb|AAC43083.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 gb|AAC76959.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 dbj|BAB38331.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           Sakai]
 gb|AAN45487.1| 50S ribosomal subunit protein L10 [Shigella flexneri 2a str. 301]
 gb|AAP18714.1| 50S ribosomal subunit protein L10 [Shigella flexneri 2a str. 2457T]
 gb|AAZ90663.1| 50S ribosomal subunit protein L10 [Shigella sonnei Ss046]
 gb|ABB63698.1| 50S ribosomal subunit protein L10 [Shigella dysenteriae Sd197]
 gb|ABB68446.1| 50S ribosomal subunit protein L10 [Shigella boydii Sb227]
 dbj|BAE77335.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. W3110]
 gb|ABE09264.1| 50S ribosomal subunit protein L10 [Escherichia coli UTI89]
 gb|ABG72149.1| 50S ribosomal protein L10 [Escherichia coli 536]
 gb|ABF06050.1| 50S ribosomal subunit protein L10 [Shigella flexneri 5 str. 8401]
 gb|ABJ03447.1| 50S ribosomal subunit protein L10 [Escherichia coli APEC O1]
 gb|ABV08388.1| ribosomal protein L10 [Escherichia coli HS]
 gb|ABV18710.1| ribosomal protein L10 [Escherichia coli O139:H28 str. E24377A]
 gb|ACA79639.1| ribosomal protein L10 [Escherichia coli ATCC 8739]
 gb|ACB04987.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. DH10B]
 gb|EDS89930.1| ribosomal protein L10 [Escherichia albertii TW07627]
 gb|ACB19620.1| ribosomal protein L10 [Escherichia coli SMS-3-5]
 gb|ACD10365.1| ribosomal protein L10 [Shigella boydii CDC 3083-94]
 gb|EDU31199.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4196]
 gb|EDU52142.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4113]
 gb|EDU66344.1| ribosomal protein L10 [Escherichia coli 53638]
 gb|EDU70858.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4076]
 gb|EDU73011.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4401]
 gb|EDU78178.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4486]
 gb|EDU83881.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4501]
 gb|EDU88580.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC869]
 gb|EDU97621.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC508]
 gb|EDV65065.1| ribosomal protein L10 [Escherichia coli F11]
 gb|EDV80596.1| ribosomal protein L10 [Escherichia coli E22]
 gb|EDV89325.1| ribosomal protein L10 [Escherichia coli E110019]
 gb|EDX28299.1| ribosomal protein L10 [Escherichia coli B171]
 gb|EDX33099.1| ribosomal protein L10 [Shigella dysenteriae 1012]
 gb|EDX37303.1| ribosomal protein L10 [Escherichia coli 101-1]
 gb|EDZ75317.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4206]
 gb|EDZ83010.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4045]
 gb|EDZ89111.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4042]
 gb|ACI39101.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4115]
 gb|ACI74221.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gb|ACI74222.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gb|ACI74223.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gb|ACI74224.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gb|ACI74225.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 dbj|BAG79796.1| 50S ribosomal protein L10 [Escherichia coli SE11]
 emb|CAS11840.1| 50S ribosomal subunit protein L10 [Escherichia coli O127:H6 str.
           E2348/69]
 gb|EEC31124.1| ribosomal protein L10 [Escherichia coli O157:H7 str. TW14588]
 emb|CAV01224.1| 50S ribosomal subunit protein L10 [Escherichia coli 55989]
 emb|CAQ91220.1| 50S ribosomal subunit protein L10 [Escherichia fergusonii ATCC
           35469]
 emb|CAR00958.1| 50S ribosomal subunit protein L10 [Escherichia coli IAI1]
 emb|CAR05615.1| 50S ribosomal subunit protein L10 [Escherichia coli S88]
 emb|CAR20476.1| 50S ribosomal subunit protein L10 [Escherichia coli IAI39]
 emb|CAR10656.1| 50S ribosomal subunit protein L10 [Escherichia coli ED1a]
 emb|CAR15632.1| 50S ribosomal subunit protein L10 [Escherichia coli UMN026]
 emb|CAP78441.1| 50S ribosomal protein L10 [Escherichia coli LF82]
 gb|EEH70506.1| 50S ribosomal protein L10 [Escherichia sp. 1_1_43]
 gb|EEH89325.1| 50S ribosomal protein L10 [Escherichia sp. 3_2_53FAA]
 gb|EEJ48026.1| ribosomal protein L10 [Escherichia coli 83972]
 gb|ACR61847.1| 50S ribosomal subunit protein L10 [Escherichia coli BW2952]
 emb|CAQ34331.1| 50S ribosomal subunit protein L10, subunit of 50S ribosomal protein
           complex L8, 50S ribosomal subunit and ribosome
           [Escherichia coli BL21(DE3)]
 gb|ACT31032.1| ribosomal protein L10 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gb|ACT41498.1| 50S ribosomal protein L10 [Escherichia coli B str. REL606]
 gb|ACT45653.1| 50S ribosomal subunit protein L10 [Escherichia coli BL21(DE3)]
 gb|ACT74744.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           TW14359]
 dbj|BAI28245.1| 50S ribosomal subunit protein L10 [Escherichia coli O26:H11 str.
           11368]
 dbj|BAI33429.1| 50S ribosomal subunit protein L10 [Escherichia coli O103:H2 str.
           12009]
 dbj|BAI38547.1| 50S ribosomal subunit protein L10 [Escherichia coli O111:H- str.
           11128]
 gb|ACX41610.1| ribosomal protein L10 [Escherichia coli DH1]
 dbj|BAI57379.1| 50S ribosomal protein L10 [Escherichia coli SE15]
 gb|ADA76355.1| 50S ribosomal protein L10 [Shigella flexneri 2002017]
 emb|CBG37176.1| 50S ribosomal subunit protein L10 [Escherichia coli 042]
 gb|ADD59233.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. CB9615]
 gb|EFE60762.1| large subunit ribosomal protein L10 [Escherichia coli B088]
 gb|EFE98409.1| rplJ [Escherichia coli FVEC1412]
 gb|EFF03812.1| 50S ribosomal protein L10 [Escherichia coli B185]
 gb|EFF10515.1| rplJ [Escherichia coli B354]
 gb|ADE89045.1| ribosomal protein L10 [Escherichia coli IHE3034]
 gb|EFI17749.1| 50S ribosomal protein L10 [Escherichia coli FVEC1302]
 gb|EFI89122.1| ribosomal protein L10 [Escherichia coli MS 196-1]
 gb|EFJ56788.1| ribosomal protein L10 [Escherichia coli MS 185-1]
 gb|EFJ61038.1| ribosomal protein L10 [Escherichia coli MS 200-1]
 gb|EFJ68039.1| ribosomal protein L10 [Escherichia coli MS 175-1]
 gb|EFJ74519.1| ribosomal protein L10 [Escherichia coli MS 198-1]
 gb|EFJ82819.1| ribosomal protein L10 [Escherichia coli MS 69-1]
 gb|EFJ84281.1| ribosomal protein L10 [Escherichia coli MS 84-1]
 gb|EFJ93017.1| ribosomal protein L10 [Escherichia coli MS 45-1]
 gb|EFJ96845.1| ribosomal protein L10 [Escherichia coli MS 115-1]
 gb|EFK01386.1| ribosomal protein L10 [Escherichia coli MS 182-1]
 gb|EFK16601.1| ribosomal protein L10 [Escherichia coli MS 116-1]
 gb|EFK19768.1| ribosomal protein L10 [Escherichia coli MS 21-1]
 gb|EFK26706.1| ribosomal protein L10 [Escherichia coli MS 187-1]
 gb|EFK43954.1| ribosomal protein L10 [Escherichia coli MS 119-7]
 gb|EFK48678.1| ribosomal protein L10 [Escherichia coli MS 107-1]
 gb|EFK70127.1| ribosomal protein L10 [Escherichia coli MS 124-1]
 gb|EFK74937.1| ribosomal protein L10 [Escherichia coli MS 78-1]
 gb|EFK90778.1| ribosomal protein L10 [Escherichia coli MS 146-1]
 gb|EFM55041.1| 50S ribosomal protein L10 [Escherichia coli NC101]
 gb|EFN36080.1| ribosomal protein L10 [Escherichia coli W]
 gb|ADN48903.1| 50S ribosomal protein L10 [Escherichia coli ABU 83972]
 gb|ADN72702.1| 50S ribosomal protein L10 [Escherichia coli UM146]
 gb|EFO55962.1| ribosomal protein L10 [Escherichia coli MS 145-7]
 gb|EFP73769.1| ribosomal L10 family protein [Shigella dysenteriae 1617]
 emb|CBJ03749.1| 50S ribosomal subunit protein L10 [Escherichia coli ETEC H10407]
 gb|EFP98661.1| ribosomal L10 family protein [Escherichia coli 1827-70]
 gb|EFR17923.1| ribosomal L10 family protein [Escherichia coli 2362-75]
 gb|ADR29386.1| 50S ribosomal protein L10 [Escherichia coli O83:H1 str. NRG 857C]
 gb|EFS13075.1| ribosomal L10 family protein [Shigella flexneri 2a str. 2457T]
 gb|ADT77637.1| 50S ribosomal subunit protein L10 [Escherichia coli W]
 dbj|BAJ45700.1| 50S ribosomal protein L10 [Escherichia coli DH1]
 gb|EFU33025.1| ribosomal protein L10 [Escherichia coli MS 85-1]
 gb|EFU47751.1| ribosomal protein L10 [Escherichia coli MS 110-3]
 gb|EFU53684.1| ribosomal protein L10 [Escherichia coli MS 153-1]
 gb|EFU59983.1| ribosomal protein L10 [Escherichia coli MS 16-3]
 gb|EFU97954.1| ribosomal L10 family protein [Escherichia coli 3431]
 gb|EFW47988.1| LSU ribosomal protein L10p (P0) [Shigella dysenteriae CDC 74-1112]
 gb|EFW54505.1| LSU ribosomal protein L10p (P0) [Shigella boydii ATCC 9905]
 gb|EFW60725.1| LSU ribosomal protein L10p (P0) [Shigella flexneri CDC 796-83]
 gb|EFW65569.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           EC1212]
 gb|EFW71738.1| LSU ribosomal protein L10p (P0) [Escherichia coli WV_060327]
 gb|EFW74765.1| LSU ribosomal protein L10p (P0) [Escherichia coli EC4100B]
 gb|EFX08715.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. G5101]
 gb|EFX13532.1| 50S ribosomal protein L10 [Escherichia coli O157:H- str. 493-89]
 gb|EFX18309.1| 50S ribosomal protein L10 [Escherichia coli O157:H- str. H 2687]
 gb|EFX23077.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. 3256-97]
 gb|EFX28219.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. USDA 5905]
 gb|EFX32914.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. LSU-61]
 gb|EFZ41701.1| ribosomal L10 family protein [Escherichia coli EPECa14]
 gb|EFZ47203.1| ribosomal protein L10 family protein [Escherichia coli E128010]
 gb|EFZ53163.1| ribosomal L10 family protein [Shigella sonnei 53G]
 gb|EFZ60131.1| ribosomal protein L10 family protein [Escherichia coli LT-68]
 gb|EFZ63123.1| ribosomal protein L10 family protein [Escherichia coli OK1180]
 gb|EFZ67492.1| ribosomal protein L10 family protein [Escherichia coli OK1357]
 gb|EFZ75436.1| ribosomal protein L10 family protein [Escherichia coli RN587/1]
 gb|ADX52894.1| ribosomal protein L10 [Escherichia coli KO11FL]
 gb|EGB30447.1| ribosomal protein L10 [Escherichia coli E1520]
 gb|EGB35118.1| ribosomal protein L10 [Escherichia coli E482]
 gb|EGB39707.1| ribosomal protein L10 [Escherichia coli H120]
 gb|EGB44740.1| ribosomal protein L10 [Escherichia coli H252]
 gb|EGB49609.1| ribosomal protein L10 [Escherichia coli H263]
 gb|EGB54586.1| ribosomal protein L10 [Escherichia coli H489]
 gb|EGB59296.1| ribosomal protein L10 [Escherichia coli M863]
 gb|EGB64366.1| ribosomal protein L10 [Escherichia coli TA007]
 gb|EGB69317.1| ribosomal protein L10 [Escherichia coli TW10509]
 gb|EGB78687.1| ribosomal protein L10 [Escherichia coli MS 57-2]
 gb|EGB84499.1| ribosomal protein L10 [Escherichia coli MS 60-1]
 gb|EGB86551.1| ribosomal protein L10 [Escherichia coli MS 117-3]
 gb|EGC04889.1| ribosomal protein L10 [Escherichia fergusonii B253]
 gb|EGC09361.1| ribosomal protein L10 [Escherichia coli E1167]
 gb|EGC97142.1| 50S ribosomal protein L10 [Escherichia fergusonii ECD227]
 gb|EGD70895.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           1125]
 gb|EGD71306.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           1044]
 gb|EGE62165.1| ribosomal protein L10 family protein [Escherichia coli STEC_7v]
 gb|EGH36821.1| LSU ribosomal protein L10p (P0) [Escherichia coli AA86]
 gb|EGI08256.1| 50S ribosomal protein L10 [Escherichia coli H736]
 gb|EGI13456.1| 50S ribosomal protein L10 [Escherichia coli M605]
 gb|EGI18694.1| 50S ribosomal protein L10 [Escherichia coli M718]
 gb|EGI24365.1| 50S ribosomal protein L10 [Escherichia coli TA206]
 gb|EGI29149.1| 50S ribosomal protein L10 [Escherichia coli TA143]
 gb|EGI33849.1| 50S ribosomal protein L10 [Escherichia coli TA271]
 gb|EGI38755.1| 50S ribosomal protein L10 [Escherichia coli TA280]
 gb|EGI43594.1| 50S ribosomal protein L10 [Escherichia coli H591]
 gb|EGI48252.1| 50S ribosomal protein L10 [Escherichia coli H299]
 gb|EGI89086.1| ribosomal protein L10 family protein [Shigella boydii 5216-82]
 gb|EGI96165.1| ribosomal protein L10 family protein [Shigella dysenteriae 155-74]
 gb|EGI97402.1| ribosomal protein L10 family protein [Shigella boydii 3594-74]
 gb|EGJ08635.1| ribosomal protein L10 [Escherichia coli D9]
 gb|AEE59308.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gb|EGJ79603.1| ribosomal protein L10 family protein [Shigella flexneri 2747-71]
 gb|EGJ81863.1| ribosomal protein L10 family protein [Shigella flexneri 4343-70]
 gb|EGJ93090.1| 50S ribosomal subunit protein L10 [Shigella flexneri 2930-71]
 gb|EGJ95781.1| ribosomal protein L10 family protein [Shigella flexneri K-671]
 gb|EGK18462.1| ribosomal protein L10 family protein [Shigella flexneri K-272]
 gb|EGK18559.1| ribosomal protein L10 family protein [Shigella flexneri K-218]
 gb|EGK30146.1| ribosomal protein L10 family protein [Shigella flexneri VA-6]
 gb|EGK33681.1| ribosomal protein L10 family protein [Shigella flexneri K-227]
 gb|EGK33689.1| ribosomal protein L10 family protein [Shigella flexneri K-304]
 gb|EGM60061.1| 50S ribosomal subunit protein L10 [Shigella flexneri SFJ17B]
 gb|AEJ59378.1| ribosomal protein L10 family protein [Escherichia coli UMNF18]
 gb|EGR61138.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 01-09591]
 gb|EGR71826.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. LB226692]
 gb|EGT71302.1| hypothetical protein C22711_5338 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGU25303.1| 50S ribosomal protein L10 [Escherichia coli XH140A]
 gb|EGU95911.1| ribosomal protein L10 [Escherichia coli MS 79-10]
 gb|EGV45790.1| 50S ribosomal protein L10 [Escherichia coli XH001]
 gb|EGW63024.1| ribosomal protein L10 family protein [Escherichia coli
           STEC_C165-02]
 gb|EGW64024.1| ribosomal protein L10 family protein [Escherichia coli 2534-86]
 gb|EGW65206.1| ribosomal protein L10 family protein [Escherichia coli STEC_B2F1]
 gb|EGW78924.1| ribosomal protein L10 family protein [Escherichia coli STEC_94C]
 gb|EGW79797.1| ribosomal protein L10 family protein [Escherichia coli 3030-1]
 gb|EGW84873.1| ribosomal protein L10 family protein [Escherichia coli
           STEC_DG131-3]
 gb|EGW89556.1| ribosomal protein L10 family protein [Escherichia coli STEC_EH250]
 gb|EGX00339.1| ribosomal protein L10 family protein [Escherichia coli G58-1]
 gb|EGX00868.1| ribosomal protein L10 family protein [Escherichia coli STEC_MHI813]
 gb|EGX02754.1| ribosomal protein L10 family protein [Escherichia coli STEC_H.1.8]
 gb|EGX14298.1| ribosomal protein L10 family protein [Escherichia coli STEC_S1191]
 gb|EGX19327.1| ribosomal protein L10 family protein [Escherichia coli TX1999]
 gb|AEQ15335.1| 50S ribosomal subunit protein L10 [Escherichia coli O7:K1 str.
           CE10]
 gb|EHF17454.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. C236-11]
 gb|EHF21231.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 04-8351]
 gb|EHF21754.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. C227-11]
 gb|EHF30426.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 09-7901]
 gb|EHF36151.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-3677]
 gb|EHF44821.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4404]
 gb|EHF48547.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4522]
 gb|EHF52059.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4623]
 gb|EHF63971.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4632
           C1]
 gb|EHF67457.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4632
           C2]
 gb|EHF69203.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4632
           C3]
 gb|EHF71902.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4632
           C4]
 gb|EHF79720.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-4632
           C5]
 gb|EHF98565.1| 50S ribosomal protein L10 [Escherichia coli cloneA_i1]
 gb|AER87049.1| 50S ribosomal protein L10 [Escherichia coli str. 'clone D i2']
 gb|AER91968.1| 50S ribosomal protein L10 [Escherichia coli str. 'clone D i14']
 dbj|BAL40545.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MDS42]
 gb|EHN80496.1| 50S ribosomal protein L10 [Escherichia coli H494]
 gb|EHN81295.1| 50S ribosomal protein L10 [Escherichia coli TA124]
 gb|EHN90386.1| 50S ribosomal protein L10 [Escherichia coli H397]
 gb|EHN96146.1| 50S ribosomal protein L10 [Escherichia coli E101]
 gb|EHO04511.1| 50S ribosomal protein L10 [Escherichia coli B093]
 gb|EHP62776.1| 50S ribosomal protein L10 [Escherichia coli 4_1_47FAA]
 gb|AEZ43135.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. RM12579]
 gb|EHU03557.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC1C]
 gb|EHU03604.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC1A]
 gb|EHU05995.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC1B]
 gb|EHU17295.1| 50S ribosomal protein L10 [Escherichia coli DEC1D]
 gb|EHU20445.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC1E]
 gb|EHU21839.1| 50S ribosomal protein L10 [Escherichia coli DEC2A]
 gb|EHU34604.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC2B]
 gb|EHU36182.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC2C]
 gb|EHU37716.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC2D]
 gb|EHU49685.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC2E]
 gb|EHU55178.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3A]
 gb|EHU65673.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3C]
 gb|EHU67134.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3B]
 gb|EHU67163.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3D]
 gb|EHU70367.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3E]
 gb|EHU80536.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC3F]
 gb|EHU86685.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC4A]
 gb|EHU89786.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC4B]
 gb|EHU99198.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC4C]
 gb|EHV15767.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC4D]
 gb|EHV20165.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC5A]
 gb|EHV21771.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC5B]
 gb|EHV31172.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC4F]
 gb|EHV31910.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC5C]
 gb|EHV33519.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC5D]
 gb|EHV42987.1| 50S ribosomal protein L10 [Escherichia coli DEC5E]
 gb|EHV51193.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC6B]
 gb|EHV51836.1| 50S ribosomal protein L10 [Escherichia coli DEC6A]
 gb|EHV54275.1| 50S ribosomal protein L10 [Escherichia coli DEC6C]
 gb|EHV66365.1| 50S ribosomal protein L10 [Escherichia coli DEC6D]
 gb|EHV68588.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC6E]
 gb|EHV72585.1| 50S ribosomal protein L10 [Escherichia coli DEC7A]
 gb|EHV83452.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC7C]
 gb|EHV85729.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC7D]
 gb|EHV90224.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC7B]
 gb|EHV96402.1| 50S ribosomal protein L10 [Escherichia coli DEC7E]
 gb|EHW04470.1| 50S ribosomal protein L10 [Escherichia coli DEC8A]
 gb|EHW07415.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC8B]
 gb|EHW09870.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC8C]
 gb|EHW19586.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC8D]
 gb|EHW29641.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC9A]
 gb|EHW34585.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC9B]
 gb|EHW37274.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC8E]
 gb|EHW40279.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC9C]
 gb|EHW47787.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC9D]
 gb|EHW50353.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC9E]
 gb|EHW55061.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10A]
 gb|EHW75415.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10D]
 gb|EHW81878.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10B]
 gb|EHW82111.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10C]
 gb|EHW84290.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10E]
 gb|EHW85450.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC11A]
 gb|EHW85480.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC10F]
 gb|EHW99038.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC11B]
 gb|EHX04822.1| 50S ribosomal protein L10 [Escherichia coli DEC11D]
 gb|EHX06567.1| 50S ribosomal protein L10 [Escherichia coli DEC11C]
 gb|EHX14989.1| 50S ribosomal protein L10 [Escherichia coli DEC11E]
 gb|EHX21687.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC12B]
 gb|EHX24928.1| 50S ribosomal protein L10 [Escherichia coli DEC12A]
 gb|EHX25419.1| 50S ribosomal protein L10 [Escherichia coli DEC12C]
 gb|EHX39371.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC12D]
 gb|EHX42410.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC13A]
 gb|EHX42449.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC12E]
 gb|EHX55577.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC13C]
 gb|EHX55591.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC13B]
 gb|EHX57788.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC13D]
 gb|EHX68339.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC13E]
 gb|EHX72096.1| 50S ribosomal protein L10 [Escherichia coli DEC14A]
 gb|EHX73773.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC14B]
 gb|EHX83686.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC14C]
 gb|EHX86426.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC14D]
 gb|EHX92601.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC15A]
 gb|EHX99380.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC15B]
 gb|EHY02126.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC15C]
 gb|EHY10376.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC15D]
 gb|EHY14738.1| 50S ribosomal subunit protein L10 [Escherichia coli DEC15E]
 gb|EIA34282.1| 50S ribosomal protein L10 [Escherichia coli SCI-07]
 gb|AFG42910.1| 50S ribosomal protein L10 [Escherichia coli P12b]
 gb|AFH15477.1| 50S ribosomal protein L10 [Escherichia coli KO11FL]
 gb|AFH13869.1| 50S ribosomal protein L10 [Escherichia coli W]
 gb|EID64280.1| 50S ribosomal protein L10 [Shigella flexneri 5a str. M90T]
 gb|EID68896.1| 50S ribosomal protein L10 [Escherichia coli W26]
 gb|EIE35003.1| 50S ribosomal protein L10 [Escherichia coli J53]
 gb|EIE53897.1| 50S ribosomal protein L10 [Escherichia coli AI27]
 gb|EIF15827.1| 50S ribosomal protein L10 [Escherichia coli O32:H37 str. P4]
 gb|EIG44992.1| 50S ribosomal protein L10 [Escherichia coli H730]
 gb|EIG45533.1| 50S ribosomal protein L10 [Escherichia coli B799]
 gb|EIG68466.1| 50S ribosomal protein L10 [Escherichia sp. 4_1_40B]
 gb|EIG80417.1| ribosomal protein L10 [Escherichia coli 1.2741]
 gb|EIG90408.1| ribosomal protein L10 [Escherichia coli 97.0246]
 gb|EIH04365.1| ribosomal protein L10 [Escherichia coli 5.0588]
 gb|EIH11885.1| ribosomal protein L10 [Escherichia coli 97.0259]
 gb|EIH22956.1| ribosomal protein L10 [Escherichia coli 1.2264]
 gb|EIH33038.1| ribosomal protein L10 [Escherichia coli 96.0497]
 gb|EIH46233.1| ribosomal protein L10 [Escherichia coli 99.0741]
 gb|EIH56783.1| ribosomal protein L10 [Escherichia coli 3.2608]
 gb|EIH64380.1| ribosomal protein L10 [Escherichia coli 93.0624]
 gb|EIH75411.1| ribosomal protein L10 [Escherichia coli 4.0522]
 gb|EIH89115.1| ribosomal protein L10 [Escherichia coli JB1-95]
 gb|EII00547.1| ribosomal protein L10 [Escherichia coli 96.154]
 gb|EII11788.1| ribosomal protein L10 [Escherichia coli 5.0959]
 gb|EII25373.1| ribosomal protein L10 [Escherichia coli 9.0111]
 gb|EII36985.1| ribosomal protein L10 [Escherichia coli 4.0967]
 gb|EII47603.1| ribosomal protein L10 [Escherichia coli 2.3916]
 gb|EII56001.1| ribosomal protein L10 [Escherichia coli 3.3884]
 gb|EII65718.1| ribosomal protein L10 [Escherichia coli 2.4168]
 gb|EII74816.1| ribosomal protein L10 [Escherichia coli 3.2303]
 gb|EII88175.1| ribosomal protein L10 [Escherichia coli 3003]
 gb|EII94398.1| ribosomal protein L10 [Escherichia coli TW07793]
 gb|EIJ01417.1| ribosomal protein L10 [Escherichia coli B41]
 gb|EIJ15680.1| ribosomal protein L10 [Escherichia coli 900105 (10e)]
 gb|AFJ31698.1| 50S ribosomal protein L10 [Escherichia coli Xuzhou21]
 gb|EIL01002.1| 50S ribosomal protein L10 [Escherichia coli O103:H25 str. CVM9340]
 gb|EIL02203.1| 50S ribosomal protein L10 [Escherichia coli O103:H2 str. CVM9450]
 gb|EIL04122.1| 50S ribosomal protein L10 [Escherichia coli O111:H11 str. CVM9534]
 gb|EIL16043.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str. CVM9570]
 gb|EIL20730.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str. CVM9574]
 gb|EIL21602.1| 50S ribosomal protein L10 [Escherichia coli O111:H11 str. CVM9545]
 gb|EIL32337.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM9942]
 gb|EIL35885.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM10026]
 gb|EIL44549.1| 50S ribosomal protein L10 [Escherichia coli KD1]
 gb|EIL50648.1| 50S ribosomal protein L10 [Escherichia coli KD2]
 gb|EIL55426.1| 50S ribosomal protein L10 [Escherichia coli 541-15]
 gb|EIL66284.1| 50S ribosomal protein L10 [Escherichia coli 75]
 gb|EIL69521.1| 50S ribosomal protein L10 [Escherichia coli 541-1]
 gb|EIL79601.1| 50S ribosomal protein L10 [Escherichia coli 576-1]
 gb|EIL80718.1| 50S ribosomal protein L10 [Escherichia coli CUMT8]
 gb|EIL81088.1| 50S ribosomal protein L10 [Escherichia coli HM605]
 gb|EIN16365.1| 50S ribosomal protein L10 [Escherichia coli FRIK1996]
 gb|EIN16510.1| 50S ribosomal protein L10 [Escherichia coli FDA505]
 gb|EIN17477.1| 50S ribosomal protein L10 [Escherichia coli FDA517]
 gb|EIN33499.1| 50S ribosomal protein L10 [Escherichia coli FRIK1985]
 gb|EIN34251.1| 50S ribosomal protein L10 [Escherichia coli 93-001]
 gb|EIN36624.1| 50S ribosomal protein L10 [Escherichia coli FRIK1990]
 gb|EIN49900.1| 50S ribosomal protein L10 [Escherichia coli PA3]
 gb|EIN53076.1| 50S ribosomal protein L10 [Escherichia coli PA5]
 gb|EIN56296.1| 50S ribosomal protein L10 [Escherichia coli PA9]
 gb|EIN66289.1| 50S ribosomal protein L10 [Escherichia coli PA10]
 gb|EIN70209.1| 50S ribosomal protein L10 [Escherichia coli PA14]
 gb|EIN71385.1| 50S ribosomal protein L10 [Escherichia coli PA15]
 gb|EIN83976.1| 50S ribosomal protein L10 [Escherichia coli PA22]
 gb|EIN89297.1| 50S ribosomal protein L10 [Escherichia coli PA24]
 gb|EIN90474.1| 50S ribosomal protein L10 [Escherichia coli PA25]
 gb|EIN96382.1| 50S ribosomal protein L10 [Escherichia coli PA28]
 gb|EIO07692.1| 50S ribosomal protein L10 [Escherichia coli PA31]
 gb|EIO08413.1| 50S ribosomal protein L10 [Escherichia coli PA32]
 gb|EIO11970.1| 50S ribosomal protein L10 [Escherichia coli PA33]
 gb|EIO24824.1| 50S ribosomal protein L10 [Escherichia coli PA40]
 gb|EIO26965.1| 50S ribosomal protein L10 [Escherichia coli PA39]
 gb|EIO30803.1| 50S ribosomal protein L10 [Escherichia coli PA41]
 gb|EIO33625.1| 50S ribosomal protein L10 [Escherichia coli PA42]
 gb|EIO46718.1| 50S ribosomal protein L10 [Escherichia coli TW06591]
 gb|EIO52765.1| 50S ribosomal protein L10 [Escherichia coli TW07945]
 gb|EIO61692.1| 50S ribosomal protein L10 [Escherichia coli TW11039]
 gb|EIO63957.1| 50S ribosomal protein L10 [Escherichia coli TW10246]
 gb|EIO66766.1| 50S ribosomal protein L10 [Escherichia coli TW09098]
 gb|EIO72445.1| 50S ribosomal protein L10 [Escherichia coli TW09109]
 gb|EIO79934.1| 50S ribosomal protein L10 [Escherichia coli TW10119]
 gb|EIO87283.1| 50S ribosomal protein L10 [Escherichia coli TW09195]
 gb|EIO88275.1| 50S ribosomal protein L10 [Escherichia coli EC4203]
 gb|EIO92971.1| 50S ribosomal protein L10 [Escherichia coli EC4196]
 gb|EIP04403.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. TW14313]
 gb|EIP06225.1| 50S ribosomal protein L10 [Escherichia coli TW14301]
 gb|EIP10941.1| 50S ribosomal protein L10 [Escherichia coli EC4421]
 gb|EIP20282.1| 50S ribosomal protein L10 [Escherichia coli EC4422]
 gb|EIP24459.1| 50S ribosomal protein L10 [Escherichia coli EC4013]
 gb|EIP28190.1| 50S ribosomal protein L10 [Escherichia coli EC4402]
 gb|EIP35704.1| 50S ribosomal protein L10 [Escherichia coli EC4439]
 gb|EIP40692.1| 50S ribosomal protein L10 [Escherichia coli EC4436]
 gb|EIP49580.1| 50S ribosomal protein L10 [Escherichia coli EC4437]
 gb|EIP50637.1| 50S ribosomal protein L10 [Escherichia coli EC4448]
 gb|EIP56708.1| 50S ribosomal protein L10 [Escherichia coli EC1738]
 gb|EIP64401.1| 50S ribosomal protein L10 [Escherichia coli EC1734]
 gb|EIP73224.1| 50S ribosomal protein L10 [Escherichia coli EC1845]
 gb|EIP73969.1| 50S ribosomal protein L10 [Escherichia coli EC1863]
 gb|EIQ04685.1| 50S ribosomal protein L10 [Shigella flexneri 2850-71]
 gb|EIQ06002.1| 50S ribosomal protein L10 [Shigella flexneri CCH060]
 gb|EIQ06403.1| 50S ribosomal protein L10 [Shigella flexneri K-1770]
 gb|EIQ17692.1| 50S ribosomal protein L10 [Shigella flexneri K-315]
 gb|EIQ23284.1| 50S ribosomal protein L10 [Shigella boydii 965-58]
 gb|EIQ30595.1| 50S ribosomal protein L10 [Shigella boydii 4444-74]
 gb|EIQ34853.1| 50S ribosomal protein L10 [Shigella flexneri K-404]
 gb|EIQ38704.1| 50S ribosomal protein L10 [Shigella sonnei 3233-85]
 gb|EIQ48431.1| 50S ribosomal protein L10 [Shigella sonnei 3226-85]
 gb|EIQ49798.1| 50S ribosomal subunit protein L10 [Shigella sonnei 4822-66]
 gb|EIQ56396.1| 50S ribosomal protein L10 [Shigella dysenteriae 225-75]
 gb|EIQ58698.1| 50S ribosomal protein L10 [Escherichia coli EPECa12]
 gb|EIQ66669.1| 50S ribosomal subunit protein L10 [Escherichia coli EPEC C342-62]
 gb|EIQ78723.1| 50S ribosomal protein L10 [Shigella flexneri 1235-66]
 gb|EJE62200.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str. CVM9634]
 gb|EJE62487.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM10224]
 gb|EJE62504.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str. CVM9602]
 gb|EJE77113.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM10021]
 gb|EJE77522.1| 50S ribosomal protein L10 [Escherichia coli O111:H11 str. CVM9553]
 gb|EJE81129.1| 50S ribosomal protein L10 [Escherichia coli O111:H11 str. CVM9455]
 gb|EJE91322.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM10030]
 gb|EJE92304.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. CVM9952]
 gb|EJK93692.1| ribosomal protein L10 family protein [Escherichia coli STEC_O31]
 gb|EJL11059.1| 50S ribosomal subunit protein L10 [Shigella sonnei str. Moseley]
 gb|EJL18750.1| 50S ribosomal subunit protein L10 [Shigella flexneri 6603-63]
 gb|EJZ62453.1| 50S ribosomal subunit protein L10 [Shigella flexneri 1485-80]
 gb|AFS59418.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           2009EL-2050]
 gb|AFS76634.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           2011C-3493]
 gb|AFS84072.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           2009EL-2071]
 gb|EKG97208.1| 50S ribosomal protein L10 [Escherichia coli PA7]
 gb|EKG97709.1| 50S ribosomal protein L10 [Escherichia coli FRIK920]
 gb|EKG98096.1| 50S ribosomal protein L10 [Escherichia coli PA34]
 gb|EKH09072.1| 50S ribosomal protein L10 [Escherichia coli FDA506]
 gb|EKH14074.1| 50S ribosomal protein L10 [Escherichia coli FDA507]
 gb|EKH21411.1| 50S ribosomal protein L10 [Escherichia coli FDA504]
 gb|EKH27329.1| 50S ribosomal protein L10 [Escherichia coli FRIK1999]
 gb|EKH33012.1| 50S ribosomal protein L10 [Escherichia coli FRIK1997]
 gb|EKH37604.1| 50S ribosomal protein L10 [Escherichia coli NE1487]
 gb|EKH43901.1| 50S ribosomal protein L10 [Escherichia coli NE037]
 gb|EKH49486.1| 50S ribosomal protein L10 [Escherichia coli FRIK2001]
 gb|EKH55296.1| 50S ribosomal protein L10 [Escherichia coli PA4]
 gb|EKH64386.1| 50S ribosomal protein L10 [Escherichia coli PA23]
 gb|EKH65976.1| 50S ribosomal protein L10 [Escherichia coli PA49]
 gb|EKH72781.1| 50S ribosomal protein L10 [Escherichia coli PA45]
 gb|EKH80239.1| 50S ribosomal protein L10 [Escherichia coli TT12B]
 gb|EKH85110.1| 50S ribosomal protein L10 [Escherichia coli MA6]
 gb|EKH89027.1| 50S ribosomal protein L10 [Escherichia coli 5905]
 gb|EKH97241.1| 50S ribosomal protein L10 [Escherichia coli CB7326]
 gb|EKI03575.1| 50S ribosomal protein L10 [Escherichia coli EC96038]
 gb|EKI06597.1| 50S ribosomal protein L10 [Escherichia coli 5412]
 gb|EKI15056.1| 50S ribosomal protein L10 [Escherichia coli TW15901]
 gb|EKI22271.1| 50S ribosomal protein L10 [Escherichia coli ARS4.2123]
 gb|EKI22445.1| 50S ribosomal protein L10 [Escherichia coli TW00353]
 gb|EKI33160.1| 50S ribosomal protein L10 [Escherichia coli 3006]
 gb|EKI34423.1| 50S ribosomal protein L10 [Escherichia coli 07798]
 gb|EKI34500.1| 50S ribosomal protein L10 [Escherichia coli PA38]
 gb|EKI47089.1| 50S ribosomal protein L10 [Escherichia coli EC1735]
 gb|EKI48020.1| 50S ribosomal protein L10 [Escherichia coli N1]
 gb|EKI57502.1| 50S ribosomal protein L10 [Escherichia coli EC1736]
 gb|EKI59813.1| 50S ribosomal protein L10 [Escherichia coli EC1737]
 gb|EKI65193.1| 50S ribosomal protein L10 [Escherichia coli EC1846]
 gb|EKI73200.1| 50S ribosomal protein L10 [Escherichia coli EC1847]
 gb|EKI77300.1| 50S ribosomal protein L10 [Escherichia coli EC1848]
 gb|EKI83497.1| 50S ribosomal protein L10 [Escherichia coli EC1849]
 gb|EKI90962.1| 50S ribosomal protein L10 [Escherichia coli EC1850]
 gb|EKI93761.1| 50S ribosomal protein L10 [Escherichia coli EC1856]
 gb|EKJ01230.1| 50S ribosomal protein L10 [Escherichia coli EC1862]
 gb|EKJ06759.1| 50S ribosomal protein L10 [Escherichia coli EC1864]
 gb|EKJ11301.1| 50S ribosomal protein L10 [Escherichia coli EC1865]
 gb|EKJ20380.1| 50S ribosomal protein L10 [Escherichia coli EC1868]
 gb|EKJ21503.1| 50S ribosomal protein L10 [Escherichia coli EC1866]
 gb|EKJ31770.1| 50S ribosomal protein L10 [Escherichia coli EC1869]
 gb|EKJ37110.1| 50S ribosomal protein L10 [Escherichia coli EC1870]
 gb|EKJ38461.1| 50S ribosomal protein L10 [Escherichia coli NE098]
 gb|EKJ48813.1| 50S ribosomal protein L10 [Escherichia coli FRIK523]
 gb|EKJ54727.1| 50S ribosomal protein L10 [Escherichia coli 0.1288]
 gb|EKJ55773.1| 50S ribosomal protein L10 [Escherichia coli 0.1304]
 gb|EKJ80404.1| 50S ribosomal protein L10 [Escherichia coli AD30]
 gb|EKK21776.1| 50S ribosomal protein L10 [Escherichia coli 5.2239]
 gb|EKK22008.1| 50S ribosomal protein L10 [Escherichia coli 3.4870]
 gb|EKK22802.1| 50S ribosomal protein L10 [Escherichia coli 6.0172]
 gb|EKK38742.1| 50S ribosomal protein L10 [Escherichia coli 8.0566]
 gb|EKK39077.1| 50S ribosomal protein L10 [Escherichia coli 8.0586]
 gb|EKK39921.1| 50S ribosomal protein L10 [Escherichia coli 8.0569]
 gb|EKK51112.1| 50S ribosomal protein L10 [Escherichia coli 10.0833]
 gb|EKK53666.1| 50S ribosomal protein L10 [Escherichia coli 8.2524]
 gb|EKK62691.1| 50S ribosomal protein L10 [Escherichia coli 10.0869]
 gb|EKK67356.1| 50S ribosomal protein L10 [Escherichia coli 88.0221]
 gb|EKK72588.1| 50S ribosomal protein L10 [Escherichia coli 8.0416]
 gb|EKK81636.1| 50S ribosomal protein L10 [Escherichia coli 10.0821]
 emb|CCK49291.1| 50S ribosomal subunit protein L10 [Escherichia coli chi7122]
 emb|CCJ46624.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|EKT92265.1| 50S ribosomal protein L10 [Escherichia coli O111:H11 str.
           CFSAN001630]
 gb|EKU00886.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           CFSAN001629]
 gb|EKU03015.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str.
           CFSAN001632]
 gb|EKV71409.1| 50S ribosomal protein L10 [Escherichia coli 88.1042]
 gb|EKV71450.1| 50S ribosomal protein L10 [Escherichia coli 89.0511]
 gb|EKV74406.1| 50S ribosomal protein L10 [Escherichia coli 88.1467]
 gb|EKV86208.1| 50S ribosomal protein L10 [Escherichia coli 90.0091]
 gb|EKV89904.1| 50S ribosomal protein L10 [Escherichia coli 90.2281]
 gb|EKV92467.1| 50S ribosomal protein L10 [Escherichia coli 90.0039]
 gb|EKW04966.1| 50S ribosomal protein L10 [Escherichia coli 93.0056]
 gb|EKW05082.1| 50S ribosomal protein L10 [Escherichia coli 93.0055]
 gb|EKW09219.1| 50S ribosomal protein L10 [Escherichia coli 94.0618]
 gb|EKW21745.1| 50S ribosomal protein L10 [Escherichia coli 95.0183]
 gb|EKW23159.1| 50S ribosomal protein L10 [Escherichia coli 95.0943]
 gb|EKW23349.1| 50S ribosomal protein L10 [Escherichia coli 95.1288]
 gb|EKW37560.1| 50S ribosomal protein L10 [Escherichia coli 96.0428]
 gb|EKW39047.1| 50S ribosomal protein L10 [Escherichia coli 96.0427]
 gb|EKW44490.1| 50S ribosomal protein L10 [Escherichia coli 96.0939]
 gb|EKW52289.1| 50S ribosomal protein L10 [Escherichia coli 96.0932]
 gb|EKW58659.1| 50S ribosomal protein L10 [Escherichia coli 96.0107]
 gb|EKW59933.1| 50S ribosomal protein L10 [Escherichia coli 97.0003]
 gb|EKW69692.1| 50S ribosomal protein L10 [Escherichia coli 97.1742]
 gb|EKW76909.1| 50S ribosomal protein L10 [Escherichia coli 99.0672]
 gb|EKW85293.1| 50S ribosomal protein L10 [Escherichia coli 97.0007]
 gb|EKW86056.1| 50S ribosomal protein L10 [Escherichia coli 99.0678]
 gb|EKW87036.1| 50S ribosomal protein L10 [Escherichia coli 99.0713]
 gb|EKY35055.1| 50S ribosomal protein L10 [Escherichia coli 96.0109]
 gb|EKY35530.1| 50S ribosomal protein L10 [Escherichia coli 97.0010]
 gb|EKY91055.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02030]
 gb|EKY91952.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           11-02033-1]
 gb|EKY92828.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02092]
 gb|EKZ06441.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02093]
 gb|EKZ07132.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02281]
 gb|EKZ09722.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02318]
 gb|EKZ22422.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-02913]
 gb|EKZ24345.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-03439]
 gb|EKZ26244.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-03943]
 gb|EKZ35422.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. 11-04080]
 gb|EKZ37611.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-9990]
 gb|EKZ40377.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-9450]
 gb|EKZ48680.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-4984]
 gb|EKZ51106.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-4986]
 gb|EKZ58600.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-4987]
 gb|EKZ62644.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-4988]
 gb|EKZ67574.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-5603]
 gb|EKZ73830.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-5604]
 gb|EKZ77884.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec12-0465]
 gb|EKZ83239.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-6006]
 gb|EKZ89823.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec12-0466]
 gb|EKZ94157.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. Ec11-9941]
 gb|ELB95313.1| 50S ribosomal protein L10 [Escherichia coli KTE2]
 gb|ELB96050.1| 50S ribosomal protein L10 [Escherichia coli KTE4]
 gb|ELC05831.1| 50S ribosomal protein L10 [Escherichia coli KTE5]
 gb|ELC13161.1| 50S ribosomal protein L10 [Escherichia coli KTE10]
 gb|ELC15539.1| 50S ribosomal protein L10 [Escherichia sp. KTE11]
 gb|ELC17337.1| 50S ribosomal protein L10 [Escherichia coli KTE12]
 gb|ELC24550.1| 50S ribosomal protein L10 [Escherichia coli KTE15]
 gb|ELC32913.1| 50S ribosomal protein L10 [Escherichia coli KTE16]
 gb|ELC34169.1| 50S ribosomal protein L10 [Escherichia coli KTE21]
 gb|ELC40594.1| 50S ribosomal protein L10 [Escherichia coli KTE25]
 gb|ELC42900.1| 50S ribosomal protein L10 [Escherichia coli KTE26]
 gb|ELC46328.1| 50S ribosomal protein L10 [Escherichia coli KTE28]
 gb|ELC52131.1| 50S ribosomal protein L10 [Escherichia coli KTE39]
 gb|ELC55865.1| 50S ribosomal protein L10 [Escherichia coli KTE44]
 gb|ELC61106.1| 50S ribosomal protein L10 [Escherichia coli KTE178]
 gb|ELC69240.1| 50S ribosomal protein L10 [Escherichia coli KTE181]
 gb|ELC76791.1| 50S ribosomal protein L10 [Escherichia coli KTE187]
 gb|ELC77629.1| 50S ribosomal protein L10 [Escherichia coli KTE188]
 gb|ELC87431.1| 50S ribosomal protein L10 [Escherichia coli KTE191]
 gb|ELC93279.1| 50S ribosomal protein L10 [Escherichia coli KTE193]
 gb|ELD01463.1| 50S ribosomal protein L10 [Escherichia coli KTE204]
 gb|ELD03882.1| 50S ribosomal protein L10 [Escherichia coli KTE201]
 gb|ELD06228.1| 50S ribosomal protein L10 [Escherichia coli KTE205]
 gb|ELD11412.1| 50S ribosomal protein L10 [Escherichia coli KTE206]
 gb|ELD16836.1| 50S ribosomal protein L10 [Escherichia coli KTE208]
 gb|ELD26193.1| 50S ribosomal protein L10 [Escherichia coli KTE210]
 gb|ELD26620.1| 50S ribosomal protein L10 [Escherichia coli KTE212]
 gb|ELD29968.1| 50S ribosomal protein L10 [Escherichia coli KTE213]
 gb|ELD38470.1| 50S ribosomal protein L10 [Escherichia coli KTE216]
 gb|ELD43170.1| 50S ribosomal protein L10 [Escherichia coli KTE214]
 gb|ELD46407.1| 50S ribosomal protein L10 [Escherichia coli KTE220]
 gb|ELD48462.1| 50S ribosomal protein L10 [Escherichia coli KTE224]
 gb|ELD57081.1| 50S ribosomal protein L10 [Escherichia coli KTE230]
 gb|ELD57112.1| 50S ribosomal protein L10 [Escherichia coli KTE228]
 gb|ELD68809.1| 50S ribosomal protein L10 [Escherichia coli KTE233]
 gb|ELD74890.1| 50S ribosomal protein L10 [Escherichia coli KTE235]
 gb|ELD74989.1| 50S ribosomal protein L10 [Escherichia coli KTE234]
 gb|ELD77956.1| 50S ribosomal protein L10 [Escherichia coli KTE236]
 gb|ELD82757.1| 50S ribosomal protein L10 [Escherichia coli KTE237]
 gb|ELD86848.1| 50S ribosomal protein L10 [Escherichia coli KTE47]
 gb|ELD93939.1| 50S ribosomal protein L10 [Escherichia coli KTE49]
 gb|ELD94755.1| 50S ribosomal protein L10 [Escherichia coli KTE51]
 gb|ELE01853.1| 50S ribosomal protein L10 [Escherichia coli KTE53]
 gb|ELE08353.1| 50S ribosomal protein L10 [Escherichia coli KTE55]
 gb|ELE15091.1| 50S ribosomal protein L10 [Escherichia coli KTE56]
 gb|ELE17395.1| 50S ribosomal protein L10 [Escherichia coli KTE57]
 gb|ELE20010.1| 50S ribosomal protein L10 [Escherichia coli KTE58]
 gb|ELE27499.1| 50S ribosomal protein L10 [Escherichia coli KTE60]
 gb|ELE29461.1| 50S ribosomal protein L10 [Escherichia coli KTE62]
 gb|ELE37838.1| 50S ribosomal protein L10 [Escherichia coli KTE66]
 gb|ELE45332.1| 50S ribosomal protein L10 [Escherichia coli KTE67]
 gb|ELE47332.1| 50S ribosomal protein L10 [Escherichia coli KTE72]
 gb|ELE51286.1| 50S ribosomal protein L10 [Escherichia coli KTE75]
 gb|ELE55448.1| 50S ribosomal protein L10 [Escherichia coli KTE76]
 gb|ELE59976.1| 50S ribosomal protein L10 [Escherichia coli KTE77]
 gb|ELE66868.1| 50S ribosomal protein L10 [Escherichia coli KTE80]
 gb|ELE75708.1| 50S ribosomal protein L10 [Escherichia coli KTE81]
 gb|ELE76526.1| 50S ribosomal protein L10 [Escherichia coli KTE83]
 gb|ELE77162.1| 50S ribosomal protein L10 [Escherichia coli KTE86]
 gb|ELE85854.1| 50S ribosomal protein L10 [Escherichia coli KTE87]
 gb|ELE86581.1| 50S ribosomal protein L10 [Escherichia coli KTE93]
 gb|ELF03678.1| 50S ribosomal protein L10 [Escherichia coli KTE111]
 gb|ELF04469.1| 50S ribosomal protein L10 [Escherichia coli KTE116]
 gb|ELF05267.1| 50S ribosomal protein L10 [Escherichia coli KTE119]
 gb|ELF07371.1| 50S ribosomal protein L10 [Escherichia coli KTE142]
 gb|ELF14087.1| 50S ribosomal protein L10 [Escherichia coli KTE143]
 gb|ELF23975.1| 50S ribosomal protein L10 [Escherichia coli KTE156]
 gb|ELF26235.1| 50S ribosomal protein L10 [Escherichia coli KTE162]
 gb|ELF29448.1| 50S ribosomal protein L10 [Escherichia coli KTE161]
 gb|ELF33925.1| 50S ribosomal protein L10 [Escherichia coli KTE169]
 gb|ELF42756.1| 50S ribosomal protein L10 [Escherichia coli KTE171]
 gb|ELF45026.1| 50S ribosomal protein L10 [Escherichia coli KTE8]
 gb|ELF47592.1| 50S ribosomal protein L10 [Escherichia coli KTE6]
 gb|ELF60743.1| 50S ribosomal protein L10 [Escherichia coli KTE9]
 gb|ELF61086.1| 50S ribosomal protein L10 [Escherichia coli KTE17]
 gb|ELF61481.1| 50S ribosomal protein L10 [Escherichia coli KTE18]
 gb|ELF70637.1| 50S ribosomal protein L10 [Escherichia coli KTE45]
 gb|ELF71707.1| 50S ribosomal protein L10 [Escherichia coli KTE23]
 gb|ELF79721.1| 50S ribosomal protein L10 [Escherichia coli KTE43]
 gb|ELF79875.1| 50S ribosomal protein L10 [Escherichia coli KTE42]
 gb|ELF83090.1| 50S ribosomal protein L10 [Escherichia coli KTE29]
 gb|ELF88589.1| 50S ribosomal protein L10 [Escherichia coli KTE22]
 gb|ELF92824.1| 50S ribosomal protein L10 [Escherichia coli KTE46]
 gb|ELG02915.1| 50S ribosomal protein L10 [Escherichia coli KTE48]
 gb|ELG09214.1| 50S ribosomal protein L10 [Escherichia coli KTE50]
 gb|ELG10730.1| 50S ribosomal protein L10 [Escherichia coli KTE54]
 gb|ELG11103.1| 50S ribosomal protein L10 [Escherichia coli KTE59]
 gb|ELG21063.1| 50S ribosomal protein L10 [Escherichia coli KTE63]
 gb|ELG21778.1| 50S ribosomal protein L10 [Escherichia coli KTE65]
 gb|ELG21809.1| 50S ribosomal protein L10 [Escherichia coli KTE78]
 gb|ELG34274.1| 50S ribosomal protein L10 [Escherichia coli KTE79]
 gb|ELG39175.1| 50S ribosomal protein L10 [Escherichia coli KTE91]
 gb|ELG40016.1| 50S ribosomal protein L10 [Escherichia coli KTE84]
 gb|ELG45451.1| 50S ribosomal protein L10 [Escherichia coli KTE101]
 gb|ELG46064.1| 50S ribosomal protein L10 [Escherichia coli KTE115]
 gb|ELG57923.1| 50S ribosomal protein L10 [Escherichia coli KTE118]
 gb|ELG62057.1| 50S ribosomal protein L10 [Escherichia coli KTE123]
 gb|ELG64816.1| 50S ribosomal protein L10 [Escherichia coli KTE136]
 gb|ELG66262.1| 50S ribosomal protein L10 [Escherichia coli KTE135]
 gb|ELG75325.1| 50S ribosomal protein L10 [Escherichia coli KTE141]
 gb|ELG77683.1| 50S ribosomal protein L10 [Escherichia coli KTE140]
 gb|ELG79770.1| 50S ribosomal protein L10 [Escherichia coli KTE144]
 gb|ELG90462.1| 50S ribosomal protein L10 [Escherichia coli KTE147]
 gb|ELG93867.1| 50S ribosomal protein L10 [Escherichia coli KTE146]
 gb|ELG98998.1| 50S ribosomal protein L10 [Escherichia coli KTE154]
 gb|ELH05049.1| 50S ribosomal protein L10 [Escherichia coli KTE158]
 gb|ELH07869.1| 50S ribosomal protein L10 [Escherichia coli KTE194]
 gb|ELH10905.1| 50S ribosomal protein L10 [Escherichia coli KTE165]
 gb|ELH14752.1| 50S ribosomal protein L10 [Escherichia coli KTE192]
 gb|ELH15437.1| 50S ribosomal protein L10 [Escherichia coli KTE173]
 gb|ELH15880.1| 50S ribosomal protein L10 [Escherichia coli KTE190]
 gb|ELH32347.1| 50S ribosomal protein L10 [Escherichia coli KTE175]
 gb|ELH39284.1| 50S ribosomal protein L10 [Escherichia coli KTE184]
 gb|ELH39558.1| 50S ribosomal protein L10 [Escherichia coli KTE183]
 gb|ELH46365.1| 50S ribosomal protein L10 [Escherichia coli KTE196]
 gb|ELH54914.1| 50S ribosomal protein L10 [Escherichia coli KTE203]
 gb|ELH56407.1| 50S ribosomal protein L10 [Escherichia coli KTE197]
 gb|ELH64469.1| 50S ribosomal protein L10 [Escherichia coli KTE209]
 gb|ELH64949.1| 50S ribosomal protein L10 [Escherichia coli KTE202]
 gb|ELH66285.1| 50S ribosomal protein L10 [Escherichia coli KTE211]
 gb|ELH69220.1| 50S ribosomal protein L10 [Escherichia coli KTE207]
 gb|ELH72443.1| 50S ribosomal protein L10 [Escherichia coli KTE215]
 gb|ELH80434.1| 50S ribosomal protein L10 [Escherichia coli KTE217]
 gb|ELH91297.1| 50S ribosomal protein L10 [Escherichia coli KTE218]
 gb|ELH97495.1| 50S ribosomal protein L10 [Escherichia coli KTE223]
 gb|ELH97698.1| 50S ribosomal protein L10 [Escherichia coli KTE229]
 gb|ELH98245.1| 50S ribosomal protein L10 [Escherichia coli KTE227]
 gb|ELI02771.1| 50S ribosomal protein L10 [Escherichia coli KTE105]
 gb|ELI06204.1| 50S ribosomal protein L10 [Escherichia coli KTE106]
 gb|ELI15069.1| 50S ribosomal protein L10 [Escherichia coli KTE109]
 gb|ELI19825.1| 50S ribosomal protein L10 [Escherichia coli KTE112]
 gb|ELI21821.1| 50S ribosomal protein L10 [Escherichia coli KTE113]
 gb|ELI25555.1| 50S ribosomal protein L10 [Escherichia coli KTE117]
 gb|ELI34443.1| 50S ribosomal protein L10 [Escherichia coli KTE120]
 gb|ELI37743.1| 50S ribosomal protein L10 [Escherichia coli KTE122]
 gb|ELI38039.1| 50S ribosomal protein L10 [Escherichia coli KTE124]
 gb|ELI49901.1| 50S ribosomal protein L10 [Escherichia coli KTE125]
 gb|ELI50411.1| 50S ribosomal protein L10 [Escherichia coli KTE128]
 gb|ELI53898.1| 50S ribosomal protein L10 [Escherichia coli KTE129]
 gb|ELI63027.1| 50S ribosomal protein L10 [Escherichia coli KTE131]
 gb|ELI66928.1| 50S ribosomal protein L10 [Escherichia coli KTE133]
 gb|ELI69415.1| 50S ribosomal protein L10 [Escherichia coli KTE137]
 gb|ELI75298.1| 50S ribosomal protein L10 [Escherichia coli KTE138]
 gb|ELI80915.1| 50S ribosomal protein L10 [Escherichia coli KTE139]
 gb|ELI83850.1| 50S ribosomal protein L10 [Escherichia coli KTE145]
 gb|ELI91622.1| 50S ribosomal protein L10 [Escherichia coli KTE148]
 gb|ELI92128.1| 50S ribosomal protein L10 [Escherichia coli KTE150]
 gb|ELI97928.1| 50S ribosomal protein L10 [Escherichia coli KTE153]
 gb|ELJ06064.1| 50S ribosomal protein L10 [Escherichia coli KTE157]
 gb|ELJ07048.1| 50S ribosomal protein L10 [Escherichia coli KTE160]
 gb|ELJ09124.1| 50S ribosomal protein L10 [Escherichia coli KTE163]
 gb|ELJ19874.1| 50S ribosomal protein L10 [Escherichia coli KTE166]
 gb|ELJ21455.1| 50S ribosomal protein L10 [Escherichia coli KTE167]
 gb|ELJ23518.1| 50S ribosomal protein L10 [Escherichia coli KTE168]
 gb|ELJ33042.1| 50S ribosomal protein L10 [Escherichia coli KTE174]
 gb|ELJ35506.1| 50S ribosomal protein L10 [Escherichia coli KTE176]
 gb|ELJ38731.1| 50S ribosomal protein L10 [Escherichia coli KTE177]
 gb|ELJ48298.1| 50S ribosomal protein L10 [Escherichia coli KTE179]
 gb|ELJ48531.1| 50S ribosomal protein L10 [Escherichia coli KTE180]
 gb|ELJ52087.1| 50S ribosomal protein L10 [Escherichia coli KTE232]
 gb|ELJ62217.1| 50S ribosomal protein L10 [Escherichia coli KTE82]
 gb|ELJ65693.1| 50S ribosomal protein L10 [Escherichia coli KTE85]
 gb|ELJ65824.1| 50S ribosomal protein L10 [Escherichia coli KTE88]
 gb|ELJ76683.1| 50S ribosomal protein L10 [Escherichia coli KTE90]
 gb|ELJ79031.1| 50S ribosomal protein L10 [Escherichia coli KTE95]
 gb|ELJ80125.1| 50S ribosomal protein L10 [Escherichia coli KTE94]
 gb|ELJ91386.1| 50S ribosomal protein L10 [Escherichia coli KTE97]
 gb|ELJ94275.1| 50S ribosomal protein L10 [Escherichia coli KTE99]
 gb|ELL39600.1| 50S ribosomal protein L10 [Escherichia coli J96]
 gb|ELL40096.1| 50S ribosomal protein L10 [Escherichia coli J96]
 emb|CCP94639.1| LSU ribosomal protein L10p (P0) [Escherichia coli O10:K5(L):H4 str.
           ATCC 23506]
 emb|CCQ02583.1| LSU ribosomal protein L10p (P0) [Escherichia coli O5:K4(L):H4 str.
           ATCC 23502]
 emb|CCQ08166.1| LSU ribosomal protein L10p (P0) [Escherichia coli Nissle 1917]
 gb|AGC84878.1| 50S ribosomal protein L10 [Escherichia coli APEC O78]
 gb|ELV14872.1| 50S ribosomal protein L10 [Escherichia coli 99.0814]
 gb|ELV15931.1| 50S ribosomal protein L10 [Escherichia coli 09BKT078844]
 gb|ELV23960.1| 50S ribosomal protein L10 [Escherichia coli 99.0815]
 gb|ELV31466.1| 50S ribosomal protein L10 [Escherichia coli 99.0816]
 gb|ELV32836.1| 50S ribosomal protein L10 [Escherichia coli 99.0839]
 gb|ELV36201.1| 50S ribosomal protein L10 [Escherichia coli 99.0848]
 gb|ELV45180.1| 50S ribosomal protein L10 [Escherichia coli 99.1753]
 gb|ELV48198.1| 50S ribosomal protein L10 [Escherichia coli 99.1775]
 gb|ELV51457.1| 50S ribosomal protein L10 [Escherichia coli 99.1793]
 gb|ELV62994.1| 50S ribosomal protein L10 [Escherichia coli 99.1805]
 gb|ELV63957.1| 50S ribosomal protein L10 [Escherichia coli ATCC 700728]
 gb|ELV64254.1| 50S ribosomal protein L10 [Escherichia coli PA11]
 gb|ELV77517.1| 50S ribosomal protein L10 [Escherichia coli PA13]
 gb|ELV77545.1| 50S ribosomal protein L10 [Escherichia coli PA19]
 gb|ELV86279.1| 50S ribosomal protein L10 [Escherichia coli PA2]
 gb|ELV92403.1| 50S ribosomal protein L10 [Escherichia coli PA47]
 gb|ELV93786.1| 50S ribosomal protein L10 [Escherichia coli PA48]
 gb|ELV99849.1| 50S ribosomal protein L10 [Escherichia coli PA8]
 gb|ELW08185.1| 50S ribosomal protein L10 [Escherichia coli 7.1982]
 gb|ELW09860.1| 50S ribosomal protein L10 [Escherichia coli 99.1781]
 gb|ELW14861.1| 50S ribosomal protein L10 [Escherichia coli 99.1762]
 gb|ELW23726.1| 50S ribosomal protein L10 [Escherichia coli PA35]
 gb|ELW29212.1| 50S ribosomal protein L10 [Escherichia coli 3.4880]
 gb|ELW31164.1| 50S ribosomal protein L10 [Escherichia coli 95.0083]
 gb|ELW38424.1| 50S ribosomal protein L10 [Escherichia coli 99.0670]
 gb|EMD03379.1| 50S ribosomal protein L10 [Escherichia coli O08]
 gb|EMD03865.1| 50S ribosomal protein L10 [Escherichia coli S17]
 gb|EMD05789.1| 50S ribosomal protein L10 [Escherichia coli SEPT362]
 gb|EMR92437.1| 50S ribosomal subunit protein L10 [Escherichia coli ONT:H33 str.
           C48/93]
 gb|EMR94895.1| 50S ribosomal subunit protein L10 [Escherichia coli O104:H4 str.
           E92/11]
 gb|EMR97570.1| 50S ribosomal subunit protein L10 [Escherichia coli O104:H4 str.
           E112/10]
 gb|EMS05976.1| 50S ribosomal subunit protein L10 [Escherichia coli O127:H27 str.
           C43/90]
 gb|EMU57314.1| 50S ribosomal protein L10 [Escherichia coli MP021552.11]
 gb|EMU65938.1| 50S ribosomal protein L10 [Escherichia coli MP021552.12]
 gb|EMU74865.1| 50S ribosomal protein L10 [Escherichia coli MP021017.6]
 gb|EMU87710.1| 50S ribosomal protein L10 [Escherichia coli MP021017.4]
 gb|EMV07182.1| 50S ribosomal protein L10 [Escherichia coli MP021017.11]
 gb|EMV12671.1| 50S ribosomal protein L10 [Escherichia coli MP021017.12]
 gb|EMV15544.1| 50S ribosomal protein L10 [Escherichia coli C-34666]
 gb|EMV16885.1| 50S ribosomal protein L10 [Escherichia coli BCE034_MS-14]
 gb|EMV29826.1| 50S ribosomal protein L10 [Escherichia coli BCE002_MS12]
 gb|EMV33901.1| 50S ribosomal protein L10 [Escherichia coli 2875000]
 gb|EMV34860.1| 50S ribosomal protein L10 [Escherichia coli BCE019_MS-13]
 gb|EMV42247.1| 50S ribosomal protein L10 [Escherichia coli 2872800]
 gb|EMV51566.1| 50S ribosomal protein L10 [Escherichia coli 2871950]
 gb|EMV53917.1| 50S ribosomal protein L10 [Escherichia coli 2867750]
 gb|EMV66459.1| 50S ribosomal protein L10 [Escherichia coli 2866550]
 gb|EMV67506.1| 50S ribosomal protein L10 [Escherichia coli 2866450]
 gb|EMV82041.1| 50S ribosomal protein L10 [Escherichia coli 2861200]
 gb|EMV86021.1| 50S ribosomal protein L10 [Escherichia coli 2865200]
 gb|EMV88202.1| 50S ribosomal protein L10 [Escherichia coli 2860050]
 gb|EMW01953.1| 50S ribosomal protein L10 [Escherichia coli 2850750]
 gb|EMW13822.1| 50S ribosomal protein L10 [Escherichia coli 2850400]
 gb|EMW14271.1| 50S ribosomal protein L10 [Escherichia coli 2845650]
 gb|EMW27541.1| 50S ribosomal protein L10 [Escherichia coli 2845350]
 gb|EMW31464.1| 50S ribosomal protein L10 [Escherichia coli 2785200]
 gb|EMW39128.1| 50S ribosomal protein L10 [Escherichia coli 2788150]
 gb|EMW45501.1| 50S ribosomal protein L10 [Escherichia coli 2780750]
 gb|EMW46887.1| 50S ribosomal protein L10 [Escherichia coli 2770900]
 gb|EMW56174.1| 50S ribosomal protein L10 [Escherichia coli 2756500]
 gb|EMW70568.1| 50S ribosomal protein L10 [Escherichia coli 2747800]
 gb|EMW75247.1| 50S ribosomal protein L10 [Escherichia coli 180600]
 gb|EMW83408.1| 50S ribosomal protein L10 [Escherichia coli 180050]
 gb|EMW91218.1| 50S ribosomal protein L10 [Escherichia coli 174750]
 gb|EMW92565.1| 50S ribosomal protein L10 [Escherichia coli ThroopD]
 gb|EMW95567.1| 50S ribosomal protein L10 [Escherichia coli P0304777.1]
 gb|EMX04652.1| 50S ribosomal protein L10 [Escherichia coli P0302308.1]
 gb|EMX11380.1| 50S ribosomal protein L10 [Escherichia coli P0302293.2]
 gb|EMX15755.1| 50S ribosomal protein L10 [Escherichia coli P0301867.1]
 gb|EMX19236.1| 50S ribosomal protein L10 [Escherichia coli MP021566.1]
 gb|EMX28139.1| 50S ribosomal protein L10 [Escherichia coli MP021561.2]
 gb|EMX34394.1| 50S ribosomal protein L10 [Escherichia coli MP021552.8]
 gb|EMX34891.1| 50S ribosomal protein L10 [Escherichia coli MP021017.1]
 gb|EMX44686.1| 50S ribosomal protein L10 [Escherichia coli MP020980.2]
 gb|EMX46146.1| 50S ribosomal protein L10 [Escherichia coli Jurua 20/10]
 gb|EMX48669.1| 50S ribosomal protein L10 [Escherichia coli MP020940.1]
 gb|EMX59097.1| 50S ribosomal protein L10 [Escherichia coli Jurua 18/11]
 gb|EMX64267.1| 50S ribosomal protein L10 [Escherichia coli Envira 8/11]
 gb|EMX71422.1| 50S ribosomal protein L10 [Escherichia coli 2726800]
 gb|EMX77828.1| 50S ribosomal protein L10 [Escherichia coli Envira 10/1]
 gb|EMX81551.1| 50S ribosomal protein L10 [Escherichia coli 2719100]
 gb|EMX85576.1| 50S ribosomal protein L10 [Escherichia coli 2720900]
 gb|EMX85625.1| 50S ribosomal protein L10 [Escherichia coli BCE001_MS16]
 gb|EMZ39060.1| 50S ribosomal protein L10 [Escherichia coli SWW33]
 gb|EMZ60265.1| 50S ribosomal protein L10 [Escherichia coli 174900]
 gb|EMZ62687.1| 50S ribosomal protein L10 [Escherichia coli 2735000]
 gb|EMZ74492.1| 50S ribosomal protein L10 [Escherichia coli 199900.1]
 gb|EMZ74725.1| 50S ribosomal protein L10 [Escherichia coli 2722950]
 gb|EMZ81625.1| 50S ribosomal protein L10 [Escherichia coli p0305293.1]
 gb|EMZ90098.1| 50S ribosomal protein L10 [Escherichia coli P0305260.1]
 gb|EMZ92878.1| 50S ribosomal protein L10 [Escherichia coli P0304816.1]
 gb|ENA00554.1| 50S ribosomal protein L10 [Escherichia coli P0299438.2]
 gb|ENA03287.1| 50S ribosomal protein L10 [Escherichia coli P0299917.1]
 gb|ENA10568.1| 50S ribosomal protein L10 [Escherichia coli P0298942.1]
 gb|ENA12397.1| 50S ribosomal protein L10 [Escherichia coli BCE008_MS-13]
 gb|ENA14907.1| 50S ribosomal protein L10 [Escherichia coli 201600.1]
 gb|ENA27087.1| 50S ribosomal protein L10 [Escherichia coli BCE007_MS-11]
 gb|ENA41805.1| 50S ribosomal protein L10 [Escherichia coli P0301867.2]
 gb|ENA47905.1| 50S ribosomal protein L10 [Escherichia coli 2726950]
 gb|ENA47959.1| 50S ribosomal protein L10 [Escherichia coli 2729250]
 gb|ENA57272.1| 50S ribosomal protein L10 [Escherichia coli 178900]
 gb|ENA62273.1| 50S ribosomal protein L10 [Escherichia coli 180200]
 gb|ENA89665.1| 50S ribosomal protein L10 [Escherichia coli 2862600]
 gb|ENA90701.1| 50S ribosomal protein L10 [Escherichia coli 2864350]
 gb|ENB04241.1| 50S ribosomal protein L10 [Escherichia coli 2866350]
 gb|ENB07995.1| 50S ribosomal protein L10 [Escherichia coli BCE008_MS-01]
 gb|ENB18345.1| 50S ribosomal protein L10 [Escherichia coli BCE011_MS-01]
 gb|ENB24371.1| 50S ribosomal protein L10 [Escherichia coli BCE030_MS-09]
 gb|ENB29934.1| 50S ribosomal protein L10 [Escherichia coli BCE032_MS-12]
 gb|ENB32018.1| 50S ribosomal protein L10 [Escherichia coli MP021561.3]
 gb|ENB35192.1| 50S ribosomal protein L10 [Escherichia coli P0298942.10]
 gb|ENB44559.1| 50S ribosomal protein L10 [Escherichia coli P0298942.11]
 gb|ENB50809.1| 50S ribosomal protein L10 [Escherichia coli P0298942.14]
 gb|ENB53538.1| 50S ribosomal protein L10 [Escherichia coli P0298942.12]
 gb|ENB56949.1| 50S ribosomal protein L10 [Escherichia coli P0298942.6]
 gb|ENB57437.1| 50S ribosomal protein L10 [Escherichia coli P0298942.2]
 gb|ENB72746.1| 50S ribosomal protein L10 [Escherichia coli P0298942.9]
 gb|ENB74202.1| 50S ribosomal protein L10 [Escherichia coli P0298942.7]
 gb|ENB84886.1| 50S ribosomal protein L10 [Escherichia coli P0299438.10]
 gb|ENB92068.1| 50S ribosomal protein L10 [Escherichia coli P0299438.11]
 gb|ENB94497.1| 50S ribosomal protein L10 [Escherichia coli P0299438.3]
 gb|ENC06198.1| 50S ribosomal protein L10 [Escherichia coli P0299438.5]
 gb|ENC10016.1| 50S ribosomal protein L10 [Escherichia coli P0299438.6]
 gb|ENC11480.1| 50S ribosomal protein L10 [Escherichia coli P0299438.7]
 gb|ENC20218.1| 50S ribosomal protein L10 [Escherichia coli P0299438.8]
 gb|ENC28274.1| 50S ribosomal protein L10 [Escherichia coli P02997067.6]
 gb|ENC50315.1| 50S ribosomal protein L10 [Escherichia coli P0299917.3]
 gb|ENC52228.1| 50S ribosomal protein L10 [Escherichia coli P0299917.4]
 gb|ENC56895.1| 50S ribosomal protein L10 [Escherichia coli P0299917.5]
 gb|ENC66640.1| 50S ribosomal protein L10 [Escherichia coli P0299917.6]
 gb|ENC67136.1| 50S ribosomal protein L10 [Escherichia coli P0299917.8]
 gb|ENC76085.1| 50S ribosomal protein L10 [Escherichia coli P0299917.7]
 gb|ENC79632.1| 50S ribosomal protein L10 [Escherichia coli P0299917.9]
 gb|ENC87552.1| 50S ribosomal protein L10 [Escherichia coli P0301867.8]
 gb|ENC88220.1| 50S ribosomal protein L10 [Escherichia coli P0301867.11]
 gb|ENC95768.1| 50S ribosomal protein L10 [Escherichia coli P0302308.10]
 gb|ENC98513.1| 50S ribosomal protein L10 [Escherichia coli P0302308.11]
 gb|END07540.1| 50S ribosomal protein L10 [Escherichia coli P0302308.3]
 gb|END11567.1| 50S ribosomal protein L10 [Escherichia coli P0302308.2]
 gb|END19297.1| 50S ribosomal protein L10 [Escherichia coli P0302308.5]
 gb|END19317.1| 50S ribosomal protein L10 [Escherichia coli P0302308.4]
 gb|END29869.1| 50S ribosomal protein L10 [Escherichia coli 179100]
 gb|END33347.1| 50S ribosomal protein L10 [Escherichia coli p0305293.13]
 gb|END37101.1| 50S ribosomal protein L10 [Escherichia coli 2733950]
 gb|END37409.1| 50S ribosomal protein L10 [Escherichia coli 2854350]
 gb|END49296.1| 50S ribosomal protein L10 [Escherichia coli MP020980.1]
 gb|END53072.1| 50S ribosomal protein L10 [Escherichia coli BCE006_MS-23]
 gb|END61756.1| 50S ribosomal protein L10 [Escherichia coli P0298942.4]
 gb|END62445.1| 50S ribosomal protein L10 [Escherichia coli P0298942.3]
 gb|END65583.1| 50S ribosomal protein L10 [Escherichia coli P0299483.1]
 gb|END75899.1| 50S ribosomal protein L10 [Escherichia coli P0299483.2]
 gb|END79789.1| 50S ribosomal protein L10 [Escherichia coli P0299483.3]
 gb|END87190.1| 50S ribosomal protein L10 [Escherichia coli P0301867.13]
 gb|END88083.1| 50S ribosomal protein L10 [Escherichia coli P0301904.3]
 gb|END94597.1| 50S ribosomal protein L10 [Escherichia coli P0302293.7]
 gb|ENE04132.1| 50S ribosomal protein L10 [Escherichia coli P0305260.2]
 gb|ENE05923.1| 50S ribosomal protein L10 [Escherichia coli p0305293.14]
 gb|ENE17487.1| 50S ribosomal protein L10 [Escherichia coli P0302293.10]
 gb|ENE19672.1| 50S ribosomal protein L10 [Escherichia coli P0302293.3]
 gb|ENE26814.1| 50S ribosomal protein L10 [Escherichia coli P0302293.4]
 gb|ENE33449.1| 50S ribosomal protein L10 [Escherichia coli P0302293.6]
 gb|ENE38082.1| 50S ribosomal protein L10 [Escherichia coli P0302293.8]
 gb|ENE42156.1| 50S ribosomal protein L10 [Escherichia coli P0304777.10]
 gb|ENE47412.1| 50S ribosomal protein L10 [Escherichia coli P0302293.9]
 gb|ENE53058.1| 50S ribosomal protein L10 [Escherichia coli P0304777.11]
 gb|ENE61625.1| 50S ribosomal protein L10 [Escherichia coli P0304777.13]
 gb|ENE66574.1| 50S ribosomal protein L10 [Escherichia coli P0304777.14]
 gb|ENE73240.1| 50S ribosomal protein L10 [Escherichia coli P0304777.15]
 gb|ENE76710.1| 50S ribosomal protein L10 [Escherichia coli P0304777.2]
 gb|ENE83663.1| 50S ribosomal protein L10 [Escherichia coli P0304777.3]
 gb|ENE90987.1| 50S ribosomal protein L10 [Escherichia coli P0304777.4]
 gb|ENE93777.1| 50S ribosomal protein L10 [Escherichia coli P0304777.5]
 gb|ENE97569.1| 50S ribosomal protein L10 [Escherichia coli P0304777.7]
 gb|ENF05444.1| 50S ribosomal protein L10 [Escherichia coli P0304777.8]
 gb|ENF08425.1| 50S ribosomal protein L10 [Escherichia coli P0304777.9]
 gb|ENF20522.1| 50S ribosomal protein L10 [Escherichia coli P0304816.10]
 gb|ENF30869.1| 50S ribosomal protein L10 [Escherichia coli P0304816.14]
 gb|ENF43226.1| 50S ribosomal protein L10 [Escherichia coli P0304816.15]
 gb|ENF46116.1| 50S ribosomal protein L10 [Escherichia coli P0304816.2]
 gb|ENF59510.1| 50S ribosomal protein L10 [Escherichia coli P0304816.7]
 gb|ENF65128.1| 50S ribosomal protein L10 [Escherichia coli P0304816.8]
 gb|ENF67545.1| 50S ribosomal protein L10 [Escherichia coli P0304816.9]
 gb|ENF70851.1| 50S ribosomal protein L10 [Escherichia coli P0305260.10]
 gb|ENF81761.1| 50S ribosomal protein L10 [Escherichia coli P0305260.12]
 gb|ENF94882.1| 50S ribosomal protein L10 [Escherichia coli P0305260.15]
 gb|ENF98092.1| 50S ribosomal protein L10 [Escherichia coli P0305260.3]
 gb|ENF99848.1| 50S ribosomal protein L10 [Escherichia coli P0305260.4]
 gb|ENG11406.1| 50S ribosomal protein L10 [Escherichia coli P0305260.6]
 gb|ENG12161.1| 50S ribosomal protein L10 [Escherichia coli P0305260.7]
 gb|ENG22108.1| 50S ribosomal protein L10 [Escherichia coli P0305260.8]
 gb|ENG26089.1| 50S ribosomal protein L10 [Escherichia coli p0305293.10]
 gb|ENG39592.1| 50S ribosomal protein L10 [Escherichia coli p0305293.12]
 gb|ENG52022.1| 50S ribosomal protein L10 [Escherichia coli p0305293.2]
 gb|ENG57508.1| 50S ribosomal protein L10 [Escherichia coli p0305293.3]
 gb|ENG68081.1| 50S ribosomal protein L10 [Escherichia coli p0305293.8]
 gb|ENG74861.1| 50S ribosomal protein L10 [Escherichia coli p0305293.9]
 gb|ENG79742.1| 50S ribosomal protein L10 [Escherichia coli 178200]
 gb|ENG93832.1| 50S ribosomal protein L10 [Escherichia coli P0301867.3]
 gb|ENG98007.1| 50S ribosomal protein L10 [Escherichia coli P0301867.5]
 gb|ENH05850.1| 50S ribosomal protein L10 [Escherichia coli P0301867.7]
 gb|ENH13971.1| 50S ribosomal protein L10 [Escherichia coli P0302308.12]
 gb|ENH16191.1| 50S ribosomal protein L10 [Escherichia coli P0302308.14]
 gb|ENH41641.1| 50S ribosomal protein L10 [Escherichia coli p0305293.5]
 gb|ENH52558.1| 50S ribosomal protein L10 [Escherichia coli p0305293.6]
 gb|ENO07284.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H43 str.
           T22]
 gb|EOQ50923.1| 50S ribosomal protein L10 [Escherichia coli KTE33]
 gb|EOR53266.1| 50S ribosomal subunit protein L10 [Escherichia coli ATCC 25922]
 gb|EOU26996.1| 50S ribosomal protein L10 [Escherichia coli KTE7]
 gb|EOU27630.1| 50S ribosomal protein L10 [Escherichia coli KTE3]
 gb|EOU27780.1| 50S ribosomal protein L10 [Escherichia coli KTE13]
 gb|EOU40289.1| 50S ribosomal protein L10 [Escherichia coli KTE35]
 gb|EOU46373.1| 50S ribosomal protein L10 [Escherichia coli KTE231]
 gb|EOU47274.1| 50S ribosomal protein L10 [Escherichia sp. KTE114]
 gb|EOU54977.1| 50S ribosomal protein L10 [Escherichia coli KTE14]
 gb|EOU59908.1| 50S ribosomal protein L10 [Escherichia coli KTE19]
 gb|EOU60418.1| 50S ribosomal protein L10 [Escherichia coli KTE20]
 gb|EOU66851.1| 50S ribosomal protein L10 [Escherichia coli KTE24]
 gb|EOU77146.1| 50S ribosomal protein L10 [Escherichia sp. KTE31]
 gb|EOU81155.1| 50S ribosomal protein L10 [Escherichia coli KTE27]
 gb|EOU85416.1| 50S ribosomal protein L10 [Escherichia coli KTE34]
 gb|EOU85602.1| 50S ribosomal protein L10 [Escherichia coli KTE36]
 gb|EOU86257.1| 50S ribosomal protein L10 [Escherichia coli KTE37]
 gb|EOV00660.1| 50S ribosomal protein L10 [Escherichia coli KTE38]
 gb|EOV03107.1| 50S ribosomal protein L10 [Escherichia coli KTE40]
 gb|EOV03138.1| 50S ribosomal protein L10 [Escherichia coli KTE195]
 gb|EOV14159.1| 50S ribosomal protein L10 [Escherichia coli KTE198]
 gb|EOV19034.1| 50S ribosomal protein L10 [Escherichia coli KTE200]
 gb|EOV19867.1| 50S ribosomal protein L10 [Escherichia coli KTE199]
 gb|EOV30775.1| 50S ribosomal protein L10 [Escherichia coli KTE219]
 gb|EOV32386.1| 50S ribosomal protein L10 [Escherichia coli KTE221]
 gb|EOV40714.1| 50S ribosomal protein L10 [Escherichia coli KTE222]
 gb|EOV45607.1| 50S ribosomal protein L10 [Escherichia coli KTE61]
 gb|EOV46008.1| 50S ribosomal protein L10 [Escherichia sp. KTE52]
 gb|EOV52749.1| 50S ribosomal protein L10 [Escherichia coli KTE64]
 gb|EOV56238.1| 50S ribosomal protein L10 [Escherichia coli KTE68]
 gb|EOV59825.1| 50S ribosomal protein L10 [Escherichia coli KTE69]
 gb|EOV68878.1| 50S ribosomal protein L10 [Escherichia coli KTE70]
 gb|EOV70653.1| 50S ribosomal protein L10 [Escherichia coli KTE71]
 gb|EOV74140.1| 50S ribosomal protein L10 [Escherichia coli KTE73]
 gb|EOV84369.1| 50S ribosomal protein L10 [Escherichia coli KTE74]
 gb|EOV86255.1| 50S ribosomal protein L10 [Escherichia coli KTE89]
 gb|EOV93131.1| 50S ribosomal protein L10 [Escherichia sp. KTE96]
 gb|EOW03624.1| 50S ribosomal protein L10 [Escherichia coli KTE98]
 gb|EOW13730.1| 50S ribosomal protein L10 [Escherichia coli KTE102]
 gb|EOW14339.1| 50S ribosomal protein L10 [Escherichia coli KTE100]
 gb|EOW16942.1| 50S ribosomal protein L10 [Escherichia coli KTE107]
 gb|EOW21628.1| 50S ribosomal protein L10 [Escherichia coli KTE103]
 gb|EOW26407.1| 50S ribosomal protein L10 [Escherichia coli KTE121]
 gb|EOW26906.1| 50S ribosomal protein L10 [Escherichia coli KTE108]
 gb|EOW31723.1| 50S ribosomal protein L10 [Escherichia coli KTE126]
 gb|EOW39948.1| 50S ribosomal protein L10 [Escherichia coli KTE130]
 gb|EOW44621.1| 50S ribosomal protein L10 [Escherichia coli KTE127]
 gb|EOW55002.1| 50S ribosomal protein L10 [Escherichia coli KTE132]
 gb|EOW55526.1| 50S ribosomal protein L10 [Escherichia coli KTE155]
 gb|EOW58455.1| 50S ribosomal protein L10 [Escherichia sp. KTE159]
 gb|EOW60088.1| 50S ribosomal protein L10 [Escherichia coli KTE134]
 gb|EOW63128.1| 50S ribosomal protein L10 [Escherichia coli KTE170]
 gb|EOW71873.1| 50S ribosomal protein L10 [Escherichia sp. KTE172]
 gb|EOW87928.1| 50S ribosomal protein L10 [Escherichia coli KTE1]
 gb|EOW88027.1| 50S ribosomal protein L10 [Escherichia coli KTE41]
 gb|EOW92693.1| 50S ribosomal protein L10 [Escherichia coli KTE182]
 gb|EOX04181.1| 50S ribosomal protein L10 [Escherichia coli KTE226]
 gb|EOX05717.1| 50S ribosomal protein L10 [Escherichia coli KTE240]
 gb|EOX14565.1| 50S ribosomal protein L10 [Escherichia coli KTE225]
 gb|EOX20140.1| 50S ribosomal protein L10 [Escherichia coli KTE185]
 gb|EOX27467.1| 50S ribosomal protein L10 [Escherichia coli KTE186]
 gb|EPH47096.1| LSU ribosomal protein L10p (P0) [Escherichia coli E2265]
 emb|CDC75909.1| 50S ribosomal protein L10 [Escherichia coli CAG:4]
 gb|EQM99267.1| 50S ribosomal protein L10 [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN02296.1| 50S ribosomal protein L10 [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN04176.1| 50S ribosomal protein L10 [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN13819.1| 50S ribosomal protein L10 [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN15095.1| 50S ribosomal protein L10 [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN24385.1| 50S ribosomal protein L10 [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN27496.1| 50S ribosomal protein L10 [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN28101.1| 50S ribosomal protein L10 [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN37116.1| 50S ribosomal protein L10 [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN41684.1| 50S ribosomal protein L10 [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN44296.1| 50S ribosomal protein L10 [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN49612.1| 50S ribosomal protein L10 [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN58468.1| 50S ribosomal protein L10 [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN60238.1| 50S ribosomal protein L10 [Escherichia coli HVH 18 (4-8589585)]
 gb|EQN63166.1| 50S ribosomal protein L10 [Escherichia coli HVH 19 (4-7154984)]
 gb|EQN71578.1| 50S ribosomal protein L10 [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN74421.1| 50S ribosomal protein L10 [Escherichia coli HVH 22 (4-2258986)]
 gb|EQN81218.1| 50S ribosomal protein L10 [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN88266.1| 50S ribosomal protein L10 [Escherichia coli HVH 25 (4-5851939)]
 gb|EQN88991.1| 50S ribosomal protein L10 [Escherichia coli HVH 26 (4-5703913)]
 gb|EQN92173.1| 50S ribosomal protein L10 [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO01526.1| 50S ribosomal protein L10 [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO02719.1| 50S ribosomal protein L10 [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO11585.1| 50S ribosomal protein L10 [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO11937.1| 50S ribosomal protein L10 [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO19102.1| 50S ribosomal protein L10 [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO27086.1| 50S ribosomal protein L10 [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO33194.1| 50S ribosomal protein L10 [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO37676.1| 50S ribosomal protein L10 [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO38562.1| 50S ribosomal protein L10 [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO41712.1| 50S ribosomal protein L10 [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO49288.1| 50S ribosomal protein L10 [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO54057.1| 50S ribosomal protein L10 [Escherichia coli HVH 41 (4-2677849)]
 gb|EQO56498.1| 50S ribosomal protein L10 [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO59749.1| 50S ribosomal protein L10 [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO67403.1| 50S ribosomal protein L10 [Escherichia coli HVH 44 (4-2298570)]
 gb|EQO76158.1| 50S ribosomal protein L10 [Escherichia coli HVH 45 (4-3129918)]
 gb|EQO78236.1| 50S ribosomal protein L10 [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO80303.1| 50S ribosomal protein L10 [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO87988.1| 50S ribosomal protein L10 [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO92508.1| 50S ribosomal protein L10 [Escherichia coli HVH 53 (4-0631051)]
 gb|EQO95194.1| 50S ribosomal protein L10 [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP04136.1| 50S ribosomal protein L10 [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP06496.1| 50S ribosomal protein L10 [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP07360.1| 50S ribosomal protein L10 [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP16325.1| 50S ribosomal protein L10 [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP20514.1| 50S ribosomal protein L10 [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP29328.1| 50S ribosomal protein L10 [Escherichia coli HVH 65 (4-2262045)]
 gb|EQP30125.1| 50S ribosomal protein L10 [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP30261.1| 50S ribosomal protein L10 [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP41889.1| 50S ribosomal protein L10 [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP45473.1| 50S ribosomal protein L10 [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP46657.1| 50S ribosomal protein L10 [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP58288.1| 50S ribosomal protein L10 [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP64844.1| 50S ribosomal protein L10 [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP64981.1| 50S ribosomal protein L10 [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP67077.1| 50S ribosomal protein L10 [Escherichia coli HVH 79 (4-2512823)]
 gb|EQP82839.1| 50S ribosomal protein L10 [Escherichia coli HVH 80 (4-2428830)]
 gb|EQP85931.1| 50S ribosomal protein L10 [Escherichia coli HVH 84 (4-1021478)]
 gb|EQP89876.1| 50S ribosomal protein L10 [Escherichia coli HVH 85 (4-0792144)]
 gb|EQP93552.1| 50S ribosomal protein L10 [Escherichia coli HVH 82 (4-2209276)]
 gb|EQP99319.1| 50S ribosomal protein L10 [Escherichia coli HVH 87 (4-5977630)]
 gb|EQP99349.1| 50S ribosomal protein L10 [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ01184.1| 50S ribosomal protein L10 [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ10788.1| 50S ribosomal protein L10 [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ15891.1| 50S ribosomal protein L10 [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ20435.1| 50S ribosomal protein L10 [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ22454.1| 50S ribosomal protein L10 [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ32250.1| 50S ribosomal protein L10 [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ35638.1| 50S ribosomal protein L10 [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ44891.1| 50S ribosomal protein L10 [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ45708.1| 50S ribosomal protein L10 [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ46211.1| 50S ribosomal protein L10 [Escherichia coli HVH 104 (4-6977960)]
 gb|EQQ54909.1| 50S ribosomal protein L10 [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ61610.1| 50S ribosomal protein L10 [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ64528.1| 50S ribosomal protein L10 [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ64559.1| 50S ribosomal protein L10 [Escherichia coli HVH 107 (4-5860571)]
 gb|EQQ71427.1| 50S ribosomal protein L10 [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ83044.1| 50S ribosomal protein L10 [Escherichia coli HVH 113 (4-7535473)]
 gb|EQQ83491.1| 50S ribosomal protein L10 [Escherichia coli HVH 112 (4-5987253)]
 gb|EQQ84095.1| 50S ribosomal protein L10 [Escherichia coli HVH 114 (4-7037740)]
 gb|EQQ98253.1| 50S ribosomal protein L10 [Escherichia coli HVH 115 (4-4465997)]
 gb|EQR02787.1| 50S ribosomal protein L10 [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR07963.1| 50S ribosomal protein L10 [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR11269.1| 50S ribosomal protein L10 [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR13231.1| 50S ribosomal protein L10 [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR16732.1| 50S ribosomal protein L10 [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR24734.1| 50S ribosomal protein L10 [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR29659.1| 50S ribosomal protein L10 [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR31732.1| 50S ribosomal protein L10 [Escherichia coli HVH 121 (4-6877826)]
 gb|EQR38952.1| 50S ribosomal protein L10 [Escherichia coli HVH 125 (4-2634716)]
 gb|EQR44661.1| 50S ribosomal protein L10 [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR50154.1| 50S ribosomal protein L10 [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR55481.1| 50S ribosomal protein L10 [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR58100.1| 50S ribosomal protein L10 [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR60984.1| 50S ribosomal protein L10 [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR70585.1| 50S ribosomal protein L10 [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR73002.1| 50S ribosomal protein L10 [Escherichia coli HVH 135 (4-4449320)]
 gb|EQR81078.1| 50S ribosomal protein L10 [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR84044.1| 50S ribosomal protein L10 [Escherichia coli HVH 137 (4-2124971)]
 gb|EQR90551.1| 50S ribosomal protein L10 [Escherichia coli HVH 138 (4-6066704)]
 gb|EQR91383.1| 50S ribosomal protein L10 [Escherichia coli HVH 139 (4-3192644)]
 gb|EQR97891.1| 50S ribosomal protein L10 [Escherichia coli HVH 140 (4-5894387)]
 gb|EQS00010.1| 50S ribosomal protein L10 [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS09715.1| 50S ribosomal protein L10 [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS11951.1| 50S ribosomal protein L10 [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS13740.1| 50S ribosomal protein L10 [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS20210.1| 50S ribosomal protein L10 [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS28895.1| 50S ribosomal protein L10 [Escherichia coli HVH 147 (4-5893887)]
 gb|EQS30137.1| 50S ribosomal protein L10 [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS34923.1| 50S ribosomal protein L10 [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS43591.1| 50S ribosomal protein L10 [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS45814.1| 50S ribosomal protein L10 [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS50153.1| 50S ribosomal protein L10 [Escherichia coli HVH 150 (4-3258106)]
 gb|EQS57777.1| 50S ribosomal protein L10 [Escherichia coli HVH 158 (4-3224287)]
 gb|EQS61553.1| 50S ribosomal protein L10 [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS71348.1| 50S ribosomal protein L10 [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS73149.1| 50S ribosomal protein L10 [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS76112.1| 50S ribosomal protein L10 [Escherichia coli HVH 162 (4-5627982)]
 gb|EQS79441.1| 50S ribosomal protein L10 [Escherichia coli HVH 164 (4-5953081)]
 gb|EQS84030.1| 50S ribosomal protein L10 [Escherichia coli HVH 167 (4-6073565)]
 gb|EQS92725.1| 50S ribosomal protein L10 [Escherichia coli HVH 169 (4-1075578)]
 gb|EQS95397.1| 50S ribosomal protein L10 [Escherichia coli HVH 171 (4-3191958)]
 gb|EQS99003.1| 50S ribosomal protein L10 [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT06193.1| 50S ribosomal protein L10 [Escherichia coli HVH 172 (4-3248542)]
 gb|EQT13878.1| 50S ribosomal protein L10 [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT15523.1| 50S ribosomal protein L10 [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT19800.1| 50S ribosomal protein L10 [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT23559.1| 50S ribosomal protein L10 [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT32706.1| 50S ribosomal protein L10 [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT33145.1| 50S ribosomal protein L10 [Escherichia coli HVH 182 (4-0985554)]
 gb|EQT40619.1| 50S ribosomal protein L10 [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT46168.1| 50S ribosomal protein L10 [Escherichia coli HVH 185 (4-2876639)]
 gb|EQT52822.1| 50S ribosomal protein L10 [Escherichia coli HVH 186 (4-3405044)]
 gb|EQT54511.1| 50S ribosomal protein L10 [Escherichia coli HVH 187 (4-4471660)]
 gb|EQT57538.1| 50S ribosomal protein L10 [Escherichia coli HVH 188 (4-2356988)]
 gb|EQT69336.1| 50S ribosomal protein L10 [Escherichia coli HVH 189 (4-3220125)]
 gb|EQT73373.1| 50S ribosomal protein L10 [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT75799.1| 50S ribosomal protein L10 [Escherichia coli HVH 190 (4-3255514)]
 gb|EQT78988.1| 50S ribosomal protein L10 [Escherichia coli HVH 192 (4-3054470)]
 gb|EQT85279.1| 50S ribosomal protein L10 [Escherichia coli HVH 193 (4-3331423)]
 gb|EQT89818.1| 50S ribosomal protein L10 [Escherichia coli HVH 195 (3-7155360)]
 gb|EQT97304.1| 50S ribosomal protein L10 [Escherichia coli HVH 196 (4-4530470)]
 gb|EQT99330.1| 50S ribosomal protein L10 [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU06081.1| 50S ribosomal protein L10 [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU06593.1| 50S ribosomal protein L10 [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU07974.1| 50S ribosomal protein L10 [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU17988.1| 50S ribosomal protein L10 [Escherichia coli HVH 200 (4-4449924)]
 gb|EQU19103.1| 50S ribosomal protein L10 [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU29137.1| 50S ribosomal protein L10 [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU30105.1| 50S ribosomal protein L10 [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU36954.1| 50S ribosomal protein L10 [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU42643.1| 50S ribosomal protein L10 [Escherichia coli HVH 205 (4-3094677)]
 gb|EQU45722.1| 50S ribosomal protein L10 [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU51904.1| 50S ribosomal protein L10 [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU56530.1| 50S ribosomal protein L10 [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU62315.1| 50S ribosomal protein L10 [Escherichia coli HVH 209 (4-3062651)]
 gb|EQU64984.1| 50S ribosomal protein L10 [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU65982.1| 50S ribosomal protein L10 [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU76017.1| 50S ribosomal protein L10 [Escherichia coli HVH 213 (4-3042928)]
 gb|EQU81681.1| 50S ribosomal protein L10 [Escherichia coli HVH 215 (4-3008371)]
 gb|EQU88446.1| 50S ribosomal protein L10 [Escherichia coli HVH 217 (4-1022806)]
 gb|EQU89960.1| 50S ribosomal protein L10 [Escherichia coli HVH 216 (4-3042952)]
 gb|EQU93318.1| 50S ribosomal protein L10 [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV02123.1| 50S ribosomal protein L10 [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV02665.1| 50S ribosomal protein L10 [Escherichia coli HVH 221 (4-3136817)]
 gb|EQV05252.1| 50S ribosomal protein L10 [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV17171.1| 50S ribosomal protein L10 [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV19756.1| 50S ribosomal protein L10 [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV22237.1| 50S ribosomal protein L10 [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV29341.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 30 (63a)]
 gb|EQV37316.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 32 (66a)]
 gb|EQV41664.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 40 (102a)]
 gb|EQV41695.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 33 (68a)]
 gb|EQV49679.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 43 (105a)]
 gb|EQV53574.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 44 (106a)]
 gb|EQV61929.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 56 (169a)]
 gb|EQV62484.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 61 (174a)]
 gb|EQV62877.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 58 (171a)]
 gb|EQV75960.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 68 (182a)]
 gb|EQV77569.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 62 (175a)]
 gb|EQV78037.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 70 (185a)]
 gb|EQV88648.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 71 (186a)]
 gb|EQV94914.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 73 (195a)]
 gb|EQV95872.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 77 (202a)]
 gb|EQV96806.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 118 (317a)]
 gb|EQW09223.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 131 (358a)]
 gb|EQW12986.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3014-1]
 gb|EQW14503.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3022-1]
 gb|EQW24891.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3033-1]
 gb|EQW27060.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3052-1]
 gb|EQW27474.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3041-1]
 gb|EQW37623.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3053-1]
 gb|EQW40070.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3065-1]
 gb|EQW46710.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3087-1]
 gb|EQW51452.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3097-1]
 gb|EQW56726.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3088-1]
 gb|EQW57257.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3108-1]
 gb|EQW62120.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3113-1]
 gb|EQW70762.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3117-1]
 gb|EQW74542.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3121-1]
 gb|EQW79752.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3122-1]
 gb|EQW82030.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3124-1]
 gb|EQW87098.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3139-1]
 gb|EQW96144.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3152-1]
 gb|EQW98558.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3140-1]
 gb|EQX05902.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3159-1]
 gb|EQX06562.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3155-1]
 gb|EQX14890.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3161-1]
 gb|EQX14934.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3160-1]
 gb|EQX19910.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3162-1]
 gb|EQX26980.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3163-1]
 gb|EQX27876.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3172-1]
 gb|EQX35026.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3173-1]
 gb|EQX39804.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3175-1]
 gb|EQX47267.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3174-1]
 gb|EQX50905.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3176-1]
 gb|EQX51981.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3178-1]
 gb|EQX62489.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3185-1]
 gb|EQX64935.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3180-1]
 gb|EQX71236.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3193-1]
 gb|EQX74660.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3190-1]
 gb|EQX80312.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3199-1]
 gb|EQX82899.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3200-1]
 gb|EQX91714.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3201-1]
 gb|EQX93511.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3206-1]
 gb|EQX95823.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3203-1]
 gb|EQY07276.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3208-1]
 gb|EQY09827.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3215-1]
 gb|EQY10601.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3212-1]
 gb|EQY16778.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3216-1]
 gb|EQY25087.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3217-1]
 gb|EQY27888.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3220-1]
 gb|EQY36035.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3221-1]
 gb|EQY37689.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3222-1]
 gb|EQY39138.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3230-1]
 gb|EQY51339.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3244-1]
 gb|EQY51370.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3233-1]
 gb|EQY52668.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3240-1]
 gb|EQY63084.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3257-1]
 gb|EQY63738.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3264-1]
 gb|EQY71670.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3268-1]
 gb|EQY80254.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3304-1]
 gb|EQY82463.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3317-1]
 gb|EQY82727.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3314-1]
 gb|EQY94199.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3329-1]
 gb|EQY94422.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3318-1]
 gb|EQY95996.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3337-1]
 gb|EQZ07650.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3341-1]
 gb|EQZ09802.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3355-1]
 gb|EQZ13593.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3391-1]
 gb|EQZ19821.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3490-1]
 gb|EQZ26558.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3592-1]
 gb|EQZ29692.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3585-1]
 gb|EQZ34538.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3617-1]
 gb|EQZ34987.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3609-1]
 gb|EQZ46719.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3632-1]
 gb|EQZ49543.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3656-1]
 gb|EQZ50069.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3662-1]
 gb|EQZ60525.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3671-1]
 gb|EQZ61878.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3682-1]
 gb|EQZ65109.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3687-1]
 gb|EQZ71930.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3694-1]
 gb|EQZ73738.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3702-1]
 gb|EQZ84411.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3703-1]
 gb|EQZ85573.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3707-1]
 gb|EQZ86551.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3705-1]
 gb|EQZ95013.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3718-1]
 gb|ERA02042.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3805-1]
 gb|ERA03966.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3821-1]
 gb|ERA13588.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3889-1]
 gb|ERA15577.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3834-1]
 gb|ERA15711.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3893-1]
 gb|ERA29995.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3955-1]
 gb|ERA30128.1| 50S ribosomal protein L10 [Escherichia coli UMEA 4075-1]
 gb|ERA40201.1| 50S ribosomal protein L10 [Escherichia coli UMEA 4076-1]
 gb|ERA42553.1| 50S ribosomal protein L10 [Escherichia coli UMEA 4207-1]
 gb|ERA47967.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3899-1]
 gb|ERA54818.1| 50S ribosomal protein L10 [Escherichia coli 95NR1]
 gb|ERA63597.1| 50S ribosomal protein L10 [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA63630.1| 50S ribosomal protein L10 [Escherichia coli HVH 155 (4-4509048)]
 gb|ERA63661.1| 50S ribosomal protein L10 [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA71728.1| 50S ribosomal protein L10 [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA81880.1| 50S ribosomal protein L10 [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA84720.1| 50S ribosomal protein L10 [Escherichia coli HVH 210 (4-3042480)]
 gb|ERA87570.1| 50S ribosomal protein L10 [Escherichia coli HVH 228 (4-7787030)]
 gb|ERA97321.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 3 (4a)]
 gb|ERA99669.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 7 (16a)]
 gb|ERB01642.1| 50S ribosomal protein L10 [Escherichia coli KOEGE 10 (25a)]
 gb|ERB11476.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3144-1]
 gb|ERB12753.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3150-1]
 gb|ERB13519.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3151-1]
 gb|ERB24465.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3271-1]
 gb|ERB29978.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3298-1]
 gb|ERB30025.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3292-1]
 gb|ERB67918.1| 50S ribosomal protein L10 [Escherichia coli B107]
 gb|ERB67956.1| 50S ribosomal protein L10 [Escherichia coli B102]
 gb|ERB69353.1| 50S ribosomal protein L10 [Escherichia coli 09BKT076207]
 gb|ERB80504.1| 50S ribosomal protein L10 [Escherichia coli B26-1]
 gb|ERB87448.1| 50S ribosomal protein L10 [Escherichia coli B26-2]
 gb|ERB92681.1| 50S ribosomal protein L10 [Escherichia coli B28-1]
 gb|ERB92883.1| 50S ribosomal protein L10 [Escherichia coli B28-2]
 gb|ERC02546.1| 50S ribosomal protein L10 [Escherichia coli B29-1]
 gb|ERC09738.1| 50S ribosomal protein L10 [Escherichia coli B29-2]
 gb|ERC11965.1| 50S ribosomal protein L10 [Escherichia coli B36-1]
 gb|ERC17462.1| 50S ribosomal protein L10 [Escherichia coli B36-2]
 gb|ERC24600.1| 50S ribosomal protein L10 [Escherichia coli B7-1]
 gb|ERC33638.1| 50S ribosomal protein L10 [Escherichia coli B7-2]
 gb|ERC34559.1| 50S ribosomal protein L10 [Escherichia coli B93]
 gb|ERC39204.1| 50S ribosomal protein L10 [Escherichia coli B94]
 gb|ERC47754.1| 50S ribosomal protein L10 [Escherichia coli B95]
 gb|ERC52411.1| 50S ribosomal protein L10 [Escherichia coli TW07509]
 gb|ERC54614.1| 50S ribosomal protein L10 [Escherichia coli 08BKT055439]
 gb|ERC62530.1| 50S ribosomal protein L10 [Escherichia coli Bd5610_99]
 gb|ERC66732.1| 50S ribosomal protein L10 [Escherichia coli T1840_97]
 gb|ERC75169.1| 50S ribosomal protein L10 [Escherichia coli T234_00]
 gb|ERC78993.1| 50S ribosomal protein L10 [Escherichia coli 14A]
 gb|ERC81616.1| 50S ribosomal protein L10 [Escherichia coli T924_01]
 gb|ERC90457.1| 50S ribosomal protein L10 [Escherichia coli 2886-75]
 gb|ERC94345.1| 50S ribosomal protein L10 [Escherichia coli B103]
 gb|ERC94764.1| 50S ribosomal protein L10 [Escherichia coli B104]
 gb|ERD06156.1| 50S ribosomal protein L10 [Escherichia coli B105]
 gb|ERD10091.1| 50S ribosomal protein L10 [Escherichia coli B106]
 gb|ERD10729.1| 50S ribosomal protein L10 [Escherichia coli B108]
 gb|ERD23276.1| 50S ribosomal protein L10 [Escherichia coli B109]
 gb|ERD24606.1| 50S ribosomal protein L10 [Escherichia coli B112]
 gb|ERD28604.1| 50S ribosomal protein L10 [Escherichia coli B113]
 gb|ERD37835.1| 50S ribosomal protein L10 [Escherichia coli B114]
 gb|ERD41098.1| 50S ribosomal protein L10 [Escherichia coli B15]
 gb|ERD46047.1| 50S ribosomal protein L10 [Escherichia coli B17]
 gb|ERD55710.1| 50S ribosomal protein L10 [Escherichia coli B40-1]
 gb|ERD56317.1| 50S ribosomal protein L10 [Escherichia coli B40-2]
 gb|ERD60068.1| 50S ribosomal protein L10 [Escherichia coli B49-2]
 gb|ERD69412.1| 50S ribosomal protein L10 [Escherichia coli B5-2]
 gb|ERD73883.1| 50S ribosomal protein L10 [Escherichia coli B83]
 gb|ERD77481.1| 50S ribosomal protein L10 [Escherichia coli B84]
 gb|ERD84589.1| 50S ribosomal protein L10 [Escherichia coli B85]
 gb|ERD89166.1| 50S ribosomal protein L10 [Escherichia coli B86]
 gb|ERE01023.1| 50S ribosomal protein L10 [Escherichia coli 08BKT77219]
 gb|ERE11269.1| 50S ribosomal protein L10 [Escherichia coli 09BKT024447]
 gb|ERE14903.1| 50S ribosomal protein L10 [Escherichia coli T1282_01]
 gb|ERE23019.1| 50S ribosomal protein L10 [Escherichia coli B89]
 gb|ERE24987.1| 50S ribosomal protein L10 [Escherichia coli B90]
 gb|ERE30050.1| 50S ribosomal protein L10 [Escherichia coli Tx1686]
 gb|ERE37626.1| 50S ribosomal protein L10 [Escherichia coli Tx3800]
 gb|ERF51892.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3652-1]
 gb|ERF95583.1| 50S ribosomal protein L10 [Escherichia coli O104:H21 str.
           CFSAN002237]
 gb|AGW11038.1| 50S ribosomal protein L10 [Escherichia coli LY180]
 emb|CDH66194.1| 50S ribosomal protein L8 [Escherichia coli PMV-1]
 gb|AGX35899.1| 50S ribosomal subunit protein L10 [synthetic Escherichia coli
           C321.deltaA]
 gb|ERO93117.1| 50S ribosomal protein L10 [Escherichia coli BWH 24]
 gb|ERO99009.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 19C]
 gb|ESA24972.1| LSU ribosomal protein L10p (P0) [Escherichia coli SCD2]
 gb|ESA25068.1| LSU ribosomal protein L10p (P0) [Escherichia coli SCD1]
 gb|ESA67221.1| ribosomal protein L10 [Escherichia coli 113303]
 gb|ESA73923.1| ribosomal protein L10 [Escherichia coli 113290]
 gb|ESA76497.1| ribosomal protein L10 [Escherichia coli 110957]
 gb|ESA83022.1| ribosomal protein L10 [Escherichia coli 907357]
 gb|ESA95282.1| ribosomal protein L10 [Escherichia coli 907713]
 gb|ESA97403.1| ribosomal protein L10 [Escherichia coli 909945-2]
 gb|ESD00834.1| ribosomal protein L10 [Escherichia coli 907391]
 gb|ESD02715.1| ribosomal protein L10 [Escherichia coli 907446]
 gb|ESD09191.1| ribosomal protein L10 [Escherichia coli 113302]
 gb|ESD10709.1| ribosomal protein L10 [Escherichia coli 907672]
 gb|ESD12979.1| ribosomal protein L10 [Escherichia coli 907700]
 gb|ESD25135.1| ribosomal protein L10 [Escherichia coli 907710]
 gb|ESD26757.1| ribosomal protein L10 [Escherichia coli 907701]
 gb|ESD31689.1| ribosomal protein L10 [Escherichia coli 907715]
 gb|ESD40604.1| ribosomal protein L10 [Escherichia coli 907892]
 gb|ESD40654.1| ribosomal protein L10 [Escherichia coli 908519]
 gb|ESD46554.1| ribosomal protein L10 [Escherichia coli 907889]
 gb|ESD55256.1| ribosomal protein L10 [Escherichia coli 908522]
 gb|ESD56904.1| ribosomal protein L10 [Escherichia coli 908521]
 gb|ESD60746.1| ribosomal protein L10 [Escherichia coli 908524]
 gb|ESD61880.1| ribosomal protein L10 [Escherichia coli 908525]
 gb|ESD74540.1| ribosomal protein L10 [Escherichia coli 908555]
 gb|ESD77750.1| ribosomal protein L10 [Escherichia coli 908541]
 gb|ESD87485.1| ribosomal protein L10 [Escherichia coli 908573]
 gb|ESD88039.1| ribosomal protein L10 [Escherichia coli 908585]
 gb|ESD95741.1| ribosomal protein L10 [Escherichia coli 908616]
 gb|ESE01175.1| ribosomal protein L10 [Escherichia coli 908624]
 gb|ESE06267.1| ribosomal protein L10 [Escherichia coli 908658]
 gb|ESE08037.1| ribosomal protein L10 [Escherichia coli 908632]
 gb|ESE18965.1| ribosomal protein L10 [Escherichia coli 908675]
 gb|ESE24227.1| ribosomal protein L10 [Escherichia coli 908691]
 gb|ESE27331.1| ribosomal protein L10 [Escherichia coli 910096-2]
 gb|ESE34346.1| ribosomal protein L10 [Escherichia coli A25922R]
 gb|ESE39006.1| ribosomal protein L10 [Escherichia coli A35218R]
 gb|AGY86616.1| 50S ribosomal protein L10 [Escherichia coli JJ1886]
 gb|ESJ99998.1| 50S ribosomal protein L10 [Escherichia coli HVH 98 (4-5799287)]
 gb|ESK02080.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3336-1]
 gb|ESK11113.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3426-1]
 gb|ESK13582.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3290-1]
 gb|ESK19672.1| 50S ribosomal protein L10 [Escherichia coli HVH 50 (4-2593475)]
 gb|ESK24057.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3693-1]
 gb|ESK25267.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3342-1]
 gb|ESK28756.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3323-1]
 gb|ESL17151.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 39]
 gb|ESL31548.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 37]
 gb|ESL32432.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 38]
 gb|ESM30349.1| 50S ribosomal protein L10 [Escherichia coli BWH 32]
 gb|ESP06257.1| 50S ribosomal protein L10 [Escherichia coli HVH 36 (4-5675286)]
 gb|ESP12339.1| 50S ribosomal protein L10 [Escherichia coli HVH 136 (4-5970458)]
 gb|ESP13531.1| 50S ribosomal protein L10 [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP15539.1| 50S ribosomal protein L10 [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP28542.1| 50S ribosomal protein L10 [Escherichia coli HVH 178 (4-3189163)]
 gb|ESP31572.1| 50S ribosomal protein L10 [Escherichia coli HVH 152 (4-3447545)]
 gb|ESP36190.1| 50S ribosomal protein L10 [Escherichia coli HVH 148 (4-3192490)]
 gb|ESP40569.1| 50S ribosomal protein L10 [Escherichia coli HVH 108 (4-6924867)]
 gb|ESP40935.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3148-1]
 emb|CDJ74221.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MC4100]
 gb|ESS93301.1| LSU ribosomal protein L10p (P0) [Escherichia coli CE418]
 gb|ESS96558.1| LSU ribosomal protein L10p (P0) [Escherichia coli CE549]
 gb|ESS98135.1| LSU ribosomal protein L10p (P0) [Escherichia coli CE516]
 gb|AHA67767.1| LSU ribosomal protein L10P [Shigella dysenteriae 1617]
 gb|EST62643.1| 50S ribosomal protein L10 [Escherichia coli P4-96]
 gb|EST63488.1| 50S ribosomal protein L10 [Escherichia coli ECC-Z]
 gb|EST64375.1| 50S ribosomal protein L10 [Escherichia coli P4-NR]
 gb|EST78324.1| 50S ribosomal protein L10 [Escherichia coli ECC-1470]
 gb|EST81948.1| 50S ribosomal protein L10 [Escherichia coli ECA-727]
 gb|ESU79955.1| LSU ribosomal protein L10P [Shigella dysenteriae WRSd3]
 gb|ESU83310.1| LSU ribosomal protein L10P [Shigella dysenteriae WRSd5]
 gb|ESV01980.1| LSU ribosomal protein L10p (P0) [Escherichia coli E1777]
 gb|ETD58897.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2215]
 gb|ETD64795.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2209]
 gb|ETE08040.1| 50S ribosomal protein L10 [Escherichia coli LAU-EC8]
 gb|ETE14937.1| 50S ribosomal protein L10 [Escherichia coli LAU-EC6]
 gb|ETE20047.1| 50S ribosomal protein L10 [Escherichia coli LAU-EC10]
 gb|ETE30719.1| 50S ribosomal protein L10 [Escherichia coli LAU-EC7]
 gb|ETE36479.1| 50S ribosomal protein L10 [Escherichia coli LAU-EC9]
 gb|ETF13580.1| 50S ribosomal protein L10 [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF13740.1| 50S ribosomal protein L10 [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF14916.1| 50S ribosomal protein L10 [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF27619.1| 50S ribosomal protein L10 [Escherichia coli HVH 214 (4-3062198)]
 gb|ETF33734.1| 50S ribosomal protein L10 [Escherichia coli UMEA 3489-1]
 gb|ETI75223.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2196]
 gb|ETI79618.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2219]
 gb|ETJ24571.1| 50S ribosomal protein L10 [Escherichia coli DORA_A_5_14_21]
 gb|ETJ60493.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2193]
 gb|ETJ68699.1| 50S ribosomal protein L10 [Escherichia coli ATCC 35150]
 gb|ETJ80784.1| 50S ribosomal protein L10 [Escherichia coli ATCC BAA-2192]
 emb|CDK45844.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS1]
 emb|CDK53629.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS5]
 gb|AHE59812.1| 50S ribosomal protein L10 [Escherichia albertii KF1]
 emb|CDK82928.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS25]
 emb|CDL29930.1| LSU ribosomal protein L10p (P0) [Escherichia coli ISC7]
 emb|CDK74562.1| LSU ribosomal protein L10p (P0) [Klebsiella pneumoniae IS22]
 emb|CDK60154.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS9]
 emb|CDL04788.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS35]
 emb|CDK89661.1| LSU ribosomal protein L10p (P0) [Escherichia coli IS29]
 gb|ETS28883.1| 50S ribosomal protein L10 [Escherichia coli O6:H16:CFA/II str. B2C]
 gb|AHG17432.1| LSU ribosomal protein L10p (P0) [Escherichia coli O145:H28 str.
           RM13516]
 gb|AHG11732.1| LSU ribosomal protein L10p (P0) [Escherichia coli O145:H28 str.
           RM13514]
 gb|ETX76560.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 43b]
 gb|ETX86234.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 43a]
 gb|ETX87217.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 20B]
 gb|ETX92246.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 20A]
 gb|ETX97649.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 19B]
 gb|ETY07786.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 19A]
 gb|ETY14124.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 17B]
 gb|ETY14440.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 15]
 gb|ETY18158.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 17A]
 gb|ETY20747.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 9]
 gb|ETY27991.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 3]
 gb|ETY36973.1| 50S ribosomal protein L10 [Escherichia coli BWH 40]
 gb|ETY40979.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 2B]
 gb|ETY47474.1| 50S ribosomal protein L10 [Escherichia coli BWH 34]
 gb|ETY53297.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 49b]
 gb|ETY56537.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 49a]
 gb|ETY61688.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 6]
 emb|CDL43806.1| LSU ribosomal protein L10p (P0) [Escherichia coli ISC41]
 gb|EWC54111.1| 50S ribosomal protein L10 [Escherichia coli EC096/10]
 gb|EWY51087.1| 50S ribosomal protein L10 [Escherichia coli MP1]
 gb|AHM30544.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AHM36652.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AHM41251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AHM41741.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AHM46375.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AHM50930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB40719.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB46690.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB48196.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB54906.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB59497.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYB64887.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|EYD80590.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S1_C1]
 gb|EYD81500.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD81784.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S3_C2]
 gb|EYD94063.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S4_C3]
 gb|EYD96689.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S4_C2]
 gb|EYD97058.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S4_C1]
 gb|EYE09937.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S3_C3]
 gb|EYE16371.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S3_C2]
 gb|EYE18524.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S3_C1]
 gb|EYE19501.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S1_C3]
 gb|EYE31961.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S1_C1]
 gb|EYE34400.1| 50S ribosomal protein L10 [Escherichia coli 1-110-08_S1_C2]
 gb|EYT03475.1| 50S ribosomal protein L10 [Escherichia coli K02]
 gb|EYU73833.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-4254]
 gb|EYU74628.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4221]
 gb|EYU82451.1| 50S ribosomal protein L10 [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU87348.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4086]
 gb|EYU90924.1| 50S ribosomal protein L10 [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU91364.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-3977]
 gb|EYV02632.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-3840]
 gb|EYV04590.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3526]
 gb|EYV05637.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-3609]
 gb|EYV14854.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3521]
 gb|EYV24034.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3518]
 gb|EYV29577.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3516]
 gb|EYV30943.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3517]
 gb|EYV38075.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3511]
 gb|EYV39033.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3510]
 gb|EYV44089.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3509]
 gb|EYV55299.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3507]
 gb|EYV56759.1| 50S ribosomal protein L10 [Escherichia coli O103:H11 str.
           2010C-3214]
 gb|EYV60241.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2009EL2109]
 gb|EYV64969.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2009EL1705]
 gb|EYV71166.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2009EL1412]
 gb|EYV79439.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5806]
 gb|EYV83003.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2009C-4659]
 gb|EYV86230.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F7350]
 gb|EYV93230.1| 50S ribosomal protein L10 [Escherichia coli O86:H34 str. 99-3124]
 gb|EYV99357.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2312]
 gb|EYW02085.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2289]
 gb|EYW05401.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2288]
 gb|EYW16594.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2287]
 gb|EYW17207.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2114]
 gb|EYW17723.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2286]
 gb|EYW29094.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2112]
 gb|EYW29225.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2113]
 gb|EYW36654.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2111]
 gb|EYW43514.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2108]
 gb|EYW44817.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2109]
 gb|EYW50582.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2107]
 gb|EYW58456.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2106]
 gb|EYW58616.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2105]
 gb|EYW69137.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2104]
 gb|EYW73896.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2103]
 gb|EYW74052.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2101]
 gb|EYW79913.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2099]
 gb|EYW92898.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. 08-4487]
 gb|EYW94850.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str. 08-4270]
 gb|EYW95934.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX01902.1| 50S ribosomal protein L10 [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX12407.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX14465.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX15714.1| 50S ribosomal protein L10 [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX18835.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2098]
 gb|EYX22343.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2097]
 gb|EYX29773.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2096]
 gb|EYX36036.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2094]
 gb|EYX40995.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2093]
 gb|EYX46732.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2092]
 gb|EYX48491.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2091]
 gb|EYX55651.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2090]
 gb|EYX61948.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str.
           2011EL-1675A]
 gb|EYX63989.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-1107]
 gb|EYX72095.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2011C-3632]
 gb|EYX72967.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2011C-3679]
 gb|EYX78845.1| 50S ribosomal protein L10 [Escherichia coli O103:H2 str.
           2011C-3750]
 gb|EYX82193.1| 50S ribosomal protein L10 [Escherichia coli O156:H25 str.
           2011C-3602]
 gb|EYX90644.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2011C-3573]
 gb|EYX95524.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3500]
 gb|EYX98446.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3537]
 gb|EYY05332.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2011C-3362]
 gb|EYY16649.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2011C-3170]
 gb|EYY16722.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3216]
 gb|EYY19791.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3108]
 gb|EYY22722.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3072]
 gb|EYY26288.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010EL1058]
 gb|EYY34733.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-4989]
 gb|EYY40741.1| 50S ribosomal protein L10 [Escherichia coli O153:H2 str.
           2010C-5034]
 gb|EYY45062.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2010C-4979C1]
 gb|EYY45458.1| 50S ribosomal protein L10 [Escherichia coli O165:H25 str.
           2010C-4874]
 gb|EYY47301.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-4966]
 gb|EYY57642.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-4824]
 gb|EYY64332.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4818]
 gb|EYY66850.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4799]
 gb|EYY73456.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4746]
 gb|EYY77097.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4735]
 gb|EYY78938.1| 50S ribosomal protein L10 [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY87040.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-4732]
 gb|EYY96146.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4715]
 gb|EYY97998.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4592]
 gb|EYZ00047.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-4622]
 gb|EYZ03418.1| 50S ribosomal protein L10 [Escherichia coli O177:NM str.
           2010C-4558]
 gb|EYZ11919.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-4557C2]
 gb|EYZ15557.1| 50S ribosomal protein L10 [Escherichia coli O103:H2 str.
           2010C-4433]
 gb|EYZ17023.1| 50S ribosomal protein L10 [Escherichia coli O103:H25 str.
           2010C-4529]
 gb|EYZ25340.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ25465.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ26457.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ41410.1| 50S ribosomal protein L10 [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ48859.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ50025.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ54369.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. 06-3555]
 gb|EYZ55057.1| 50S ribosomal protein L10 [Escherichia coli O79:H7 str. 06-3501]
 gb|EYZ65392.1| 50S ribosomal protein L10 [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ69482.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str. 06-3484]
 gb|EYZ71559.1| 50S ribosomal protein L10 [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ78572.1| 50S ribosomal protein L10 [Escherichia coli O118:H16 str. 06-3256]
 gb|EYZ78869.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. 06-3003]
 gb|EYZ80964.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ93500.1| 50S ribosomal protein L10 [Escherichia coli O119:H4 str. 03-3458]
 gb|EYZ96994.1| 50S ribosomal protein L10 [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA01848.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. 03-3484]
 gb|EZA12455.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA12819.1| 50S ribosomal protein L10 [Escherichia coli O81:NM str. 02-3012]
 gb|EZA22656.1| 50S ribosomal protein L10 [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA25381.1| 50S ribosomal protein L10 [Escherichia coli O28ac:NM str. 02-3404]
 gb|EZA26163.1| 50S ribosomal protein L10 [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA31880.1| 50S ribosomal protein L10 [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA32764.1| 50S ribosomal protein L10 [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA40027.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA63801.1| 50S ribosomal protein L10 [Escherichia coli O104:H21 str. 94-3025]
 gb|EZA68774.1| 50S ribosomal protein L10 [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA71143.1| 50S ribosomal protein L10 [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA71622.1| 50S ribosomal protein L10 [Escherichia coli O25:NM str. E2539C1]
 gb|EZA82053.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str. F6627]
 gb|EZA84109.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F6142]
 gb|EZA90309.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. F6714]
 gb|EZA97411.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F6750]
 gb|EZA99493.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F6749]
 gb|EZB01743.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F6751]
 gb|EZB11984.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F7384]
 gb|EZB14268.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F7377]
 gb|EZB23149.1| 50S ribosomal protein L10 [Escherichia coli O169:H41 str. F9792]
 gb|EZB25122.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. G5303]
 gb|EZB30823.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. F7410]
 gb|EZB35957.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. H2495]
 gb|EZB36878.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. H2498]
 gb|EZB39659.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1420]
 gb|EZB50252.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1793]
 gb|EZB51555.1| 50S ribosomal protein L10 [Escherichia coli O15:H18 str. K1516]
 gb|EZB63659.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1792]
 gb|EZB68638.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1795]
 gb|EZB68970.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1796]
 gb|EZB73192.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1845]
 gb|EZB83614.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1927]
 gb|EZB83639.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K1921]
 gb|EZB86102.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2188]
 gb|EZB98214.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2191]
 gb|EZC01085.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2324]
 gb|EZC03938.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2192]
 gb|EZC11489.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2581]
 gb|EZC12997.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2622]
 gb|EZC20475.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2845]
 gb|EZC22088.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K2854]
 gb|EZC31630.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K4396]
 gb|EZC33249.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K4405]
 gb|EZC37307.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K4406]
 gb|EZC44894.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K4527]
 gb|EZC45227.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. K5269]
 gb|EZC46589.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str. K5198]
 gb|EZC54120.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5418]
 gb|EZC64492.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5448]
 gb|EZC67206.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5453]
 gb|EZC67616.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5449]
 gb|EZC77394.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5460]
 gb|EZC84650.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5467]
 gb|EZC89081.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5602]
 gb|EZC91186.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5607]
 gb|EZC98741.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5609]
 gb|EZC99417.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K6590]
 gb|EZD01214.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K5852]
 gb|EZD10115.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K6676]
 gb|EZD18063.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6723]
 gb|EZD22199.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K6687]
 gb|EZD26132.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6722]
 gb|EZD32709.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6890]
 gb|EZD36153.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6728]
 gb|EZD43493.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6895]
 gb|EZD49406.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6897]
 gb|EZD50567.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6898]
 gb|EZD56570.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6904]
 gb|EZD65165.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6908]
 gb|EZD65340.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. K7140]
 gb|EZD67332.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. K6915]
 gb|EZD78126.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD80205.1| 50S ribosomal protein L10 [Escherichia coli O39:NM str. F8704-2]
 gb|EZD88564.1| 50S ribosomal protein L10 [Escherichia coli O157:NM str. 08-4540]
 gb|EZD92963.1| 50S ribosomal protein L10 [Escherichia coli O91:H14 str.
           2009C-3227]
 gb|EZD96021.1| 50S ribosomal protein L10 [Escherichia coli O103:H2 str.
           2009C-3279]
 gb|EZD99709.1| 50S ribosomal protein L10 [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE05577.1| 50S ribosomal protein L10 [Escherichia coli O145:H28 str.
           2009C-3292]
 gb|EZE13203.1| 50S ribosomal protein L10 [Escherichia coli O121:H7 str.
           2009C-3299]
 gb|EZE17572.1| 50S ribosomal protein L10 [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE19868.1| 50S ribosomal protein L10 [Escherichia coli O69:H11 str.
           2009C-3601]
 gb|EZE20443.1| 50S ribosomal protein L10 [Escherichia coli O123:H11 str.
           2009C-3307]
 gb|EZE33436.1| 50S ribosomal protein L10 [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE37899.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2009C-4006]
 gb|EZE39042.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2009C-4050]
 gb|EZE41864.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2009C-4052]
 gb|EZE53272.1| 50S ribosomal protein L10 [Escherichia coli O118:H16 str.
           2009C-4446]
 gb|EZE58550.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2009C-4258]
 gb|EZE58871.1| 50S ribosomal protein L10 [Escherichia coli O91:H21 str.
           2009C-4646]
 gb|EZE67890.1| 50S ribosomal protein L10 [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE71138.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2009C-4750]
 gb|EZE80632.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2009EL1913]
 gb|EZE81183.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2009EL1449]
 gb|EZE87922.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2009EL1302]
 gb|EZE92370.1| 50S ribosomal protein L10 [Escherichia coli O145:NM str.
           2010C-3508]
 gb|EZE96421.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2010C-3794]
 gb|EZF03054.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2290]
 gb|EZF09613.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str.
           2011EL-2313]
 gb|EZG30438.1| 50S ribosomal protein L10 [Escherichia coli E1728]
 gb|EZG45526.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG46237.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG56438.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-4819]
 gb|EZG57582.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-4430]
 gb|EZG68370.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-5028]
 gb|EZG69267.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-4834]
 gb|EZG83103.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010EL-1699]
 gb|EZG88363.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3270]
 gb|EZG93579.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3387]
 gb|EZG94974.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3506]
 gb|EZH03233.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3282]
 gb|EZH06892.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3655]
 gb|EZH08234.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2009C-3612]
 gb|EZH15809.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2009C-3689]
 gb|EZH20655.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2009C-3996]
 gb|EZH21218.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2009C-4760]
 gb|EZH24632.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2009C-4826]
 gb|EZH36535.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-3051]
 gb|EZH39485.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-3472]
 gb|EZH44551.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-3871]
 gb|EZH51895.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-3902]
 gb|EZH53176.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2010C-4244]
 gb|EZJ14967.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ15943.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ29469.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ34282.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ34447.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ38766.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ47867.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S4_C2]
 gb|EZJ51957.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ58258.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ65545.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ65772.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ66499.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ79717.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ81458.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ87768.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ91764.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ92142.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S1_C3]
 gb|EZK05199.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S1_C3]
 gb|EZK10800.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S1_C3]
 gb|EZK14166.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S1_C2]
 gb|EZK16467.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S1_C2]
 gb|EZK26997.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S1_C2]
 gb|EZK27803.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK37535.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ27508.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str.
           2010C-3053]
 gb|EZQ27536.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str.
           2009EL-2169]
 gb|EZQ33216.1| 50S ribosomal protein L10 [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ35192.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str.
           2009C-4126]
 gb|EZQ37188.1| 50S ribosomal protein L10 [Escherichia coli O111:H8 str.
           2011C-3453]
 gb|EZQ40913.1| 50S ribosomal protein L10 [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ51499.1| 50S ribosomal protein L10 [Escherichia coli O157: str. 2010EL-2044]
 gb|EZQ55728.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 83]
 gb|EZQ60417.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 82]
 gb|AHY67755.1| LSU ribosomal protein L10p (P0) [Escherichia coli O145:H28 str.
           RM12761]
 gb|AHY73555.1| LSU ribosomal protein L10p (P0) [Escherichia coli O145:H28 str.
           RM12581]
 gb|KCW94487.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDA56088.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA61272.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S1_C1]
 gb|KDA66225.1| 50S ribosomal protein L10 [Escherichia coli 1-182-04_S1_C2]
 gb|KDA70826.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S3_C2]
 gb|KDA77934.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S3_C2]
 gb|KDA83123.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S3_C3]
 gb|KDA87657.1| 50S ribosomal protein L10 [Escherichia coli 1-176-05_S4_C2]
 emb|CDP73630.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CDP65890.1| 50S ribosomal protein L10 [Escherichia coli D6-113.11]
 emb|CDP75453.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KDF66146.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 58]
 gb|KDF76741.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 59]
 gb|KDF79099.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 64]
 gb|KDF80336.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 63]
 gb|KDF80674.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 62]
 gb|KDF96672.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 70]
 gb|KDF97434.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 65]
 gb|KDG02546.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 71]
 gb|KDG08518.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 72]
 gb|KDG13550.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 73]
 gb|KDG17986.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 74]
 gb|KDG20401.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 75]
 gb|KDG21616.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 76]
 gb|KDG34847.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 77]
 gb|KDG36513.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 79]
 gb|KDG37959.1| 50S ribosomal protein L10 [Escherichia coli BIDMC 78]
 gb|KDG46246.1| 50S ribosomal protein L10 [Escherichia coli CHS 68]
 gb|KDG51454.1| 50S ribosomal protein L10 [Escherichia coli CHS 77]
 gb|KDG56826.1| 50S ribosomal protein L10 [Escherichia coli MGH 57]
 gb|KDG56970.1| 50S ribosomal protein L10 [Escherichia coli CHS 69]
 gb|KDG68724.1| 50S ribosomal protein L10 [Escherichia coli UCI 51]
 gb|KDG69629.1| 50S ribosomal protein L10 [Escherichia coli MGH 58]
 gb|KDG70026.1| 50S ribosomal protein L10 [Escherichia coli UCI 53]
 gb|KDG82072.1| 50S ribosomal protein L10 [Escherichia coli UCI 57]
 gb|KDG84821.1| 50S ribosomal protein L10 [Escherichia coli UCI 58]
 gb|KDG89803.1| 50S ribosomal protein L10 [Escherichia coli UCI 65]
 gb|KDG92014.1| 50S ribosomal protein L10 [Escherichia coli UCI 66]
 gb|KDM70018.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDM77703.1| 50S ribosomal protein L10 [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM78413.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDM85009.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDN08233.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 emb|CDN84823.1| 50S ribosomal protein L8 [Escherichia coli O25b:H4-ST131]
 gb|KDO88188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDP18450.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDS95402.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S3_C1]
 gb|KDS95465.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S1_C3]
 gb|KDT03256.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S4_C1]
 gb|KDT10671.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT13145.1| 50S ribosomal protein L10 [Escherichia coli 2-011-08_S4_C3]
 gb|KDT16837.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S3_C1]
 gb|KDT24692.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S4_C1]
 gb|KDT31300.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S1_C1]
 gb|KDT33445.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S3_C1]
 gb|KDT41587.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S4_C2]
 gb|KDT45339.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S3_C2]
 gb|KDT52651.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S4_C3]
 gb|KDT57819.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S3_C1]
 gb|KDT58488.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S1_C3]
 gb|KDT64656.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S3_C1]
 gb|KDT71354.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S3_C3]
 gb|KDT77279.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S1_C2]
 gb|KDT82459.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S4_C1]
 gb|KDT86122.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S1_C1]
 gb|KDT90471.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S4_C1]
 gb|KDT98412.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S1_C2]
 gb|KDU07786.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S3_C2]
 gb|KDU08314.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S3_C3]
 gb|KDU15503.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S1_C1]
 gb|KDU22491.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S4_C2]
 gb|KDU31073.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S4_C2]
 gb|KDU34619.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S4_C1]
 gb|KDU37377.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S1_C3]
 gb|KDU43545.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S1_C1]
 gb|KDU53242.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S4_C1]
 gb|KDU53860.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S4_C2]
 gb|KDU59883.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S1_C1]
 gb|KDU69030.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S4_C3]
 gb|KDV13763.1| 50S ribosomal protein L10 [Escherichia coli O111:NM str. 01-3076]
 gb|KDV17659.1| 50S ribosomal protein L10 [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV32949.1| 50S ribosomal protein L10 [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV37582.1| 50S ribosomal protein L10 [Escherichia coli O145:H25 str. 07-3858]
 gb|KDV40297.1| 50S ribosomal protein L10 [Escherichia coli O146:H21 str.
           2010C-3325]
 gb|KDV45830.1| 50S ribosomal protein L10 [Escherichia coli O91:H21 str.
           2009C-3740]
 gb|KDV54400.1| 50S ribosomal protein L10 [Escherichia coli O121:H19 str.
           2011C-3609]
 gb|KDV59221.1| 50S ribosomal protein L10 [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV62539.1| 50S ribosomal protein L10 [Escherichia coli O128:H2 str.
           2011C-3317]
 gb|KDV68041.1| 50S ribosomal protein L10 [Escherichia coli O26:H11 str.
           2011C-3274]
 gb|KDV73703.1| 50S ribosomal protein L10 [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV78255.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV80954.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S3_C3]
 gb|KDV81669.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S4_C3]
 gb|KDV97649.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S3_C1]
 gb|KDV97689.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S1_C3]
 gb|KDW03599.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S3_C3]
 gb|KDW12421.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S3_C1]
 gb|KDW14073.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S4_C1]
 gb|KDW16071.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S1_C1]
 gb|KDW27713.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S1_C2]
 gb|KDW28849.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S3_C2]
 gb|KDW36901.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW40414.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S4_C2]
 gb|KDW48601.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S1_C3]
 gb|KDW54448.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S3_C1]
 gb|KDW62204.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW64234.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S3_C3]
 gb|KDW69327.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S1_C1]
 gb|KDW71727.1| 50S ribosomal protein L10 [Escherichia coli 2-005-03_S4_C1]
 gb|KDW78133.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S1_C2]
 gb|KDW85617.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S4_C1]
 gb|KDW90128.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S1_C2]
 gb|KDX02195.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S3_C1]
 gb|KDX11042.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S4_C3]
 gb|KDX18509.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S3_C3]
 gb|KDX23599.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S4_C2]
 gb|KDX25409.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S1_C2]
 gb|KDX25673.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S1_C1]
 gb|KDX38167.1| 50S ribosomal protein L10 [Escherichia coli 2-156-04_S4_C3]
 gb|KDX41887.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S3_C2]
 gb|KDX46608.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S4_C1]
 gb|KDX56896.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S3_C1]
 gb|KDX60255.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S4_C2]
 gb|KDX63597.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S4_C3]
 gb|KDX64303.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S1_C1]
 gb|KDX72652.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S1_C2]
 gb|KDX76706.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S1_C3]
 gb|KDX83867.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S3_C3]
 gb|KDX93564.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S4_C2]
 gb|KDX96724.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S3_C1]
 gb|KDX98170.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S3_C2]
 gb|KDY01608.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S3_C3]
 gb|KDY08275.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S4_C1]
 gb|KDY14596.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S4_C3]
 gb|KDY23099.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S4_C2]
 gb|KDY27390.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S3_C3]
 gb|KDY28422.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S3_C1]
 gb|KDY39995.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S4_C1]
 gb|KDY40573.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY50810.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S3_C1]
 gb|KDY63410.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S4_C2]
 gb|KDY65725.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S3_C2]
 gb|KDY68720.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY72893.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S4_C3]
 gb|KDY76956.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S1_C1]
 gb|KDY84997.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S3_C1]
 gb|KDY86927.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S1_C3]
 gb|KDY92287.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S3_C2]
 gb|KDY99791.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ07129.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ15277.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ19789.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ21564.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ23251.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ30065.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ35488.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ37749.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ46589.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ46876.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S1_C1]
 gb|KDZ59709.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ60567.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ71946.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ72692.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ78536.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ79276.1| 50S ribosomal protein L10 [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ88160.1| 50S ribosomal protein L10 [Escherichia coli 3-105-05_S1_C3]
 gb|KDZ96356.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ05353.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ05546.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ06034.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ20794.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ21764.1| 50S ribosomal protein L10 [Escherichia coli 2-316-03_S1_C2]
 gb|KEJ26213.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ37164.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ43372.1| 50S ribosomal protein L10 [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ46184.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ54108.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ56473.1| 50S ribosomal protein L10 [Escherichia coli 3-267-03_S4_C1]
 gb|KEJ65920.1| 50S ribosomal protein L10 [Escherichia coli 3-020-07_S3_C2]
 gb|KEJ71239.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S1_C3]
 gb|KEJ73799.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S3_C2]
 gb|KEK77300.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S1_C2]
 gb|KEK77738.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S3_C1]
 gb|KEK82265.1| 50S ribosomal protein L10 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK90790.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S1_C2]
 gb|KEK94898.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S3_C3]
 gb|KEL00104.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S1_C3]
 gb|KEL06345.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S4_C2]
 gb|KEL07656.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S3_C2]
 gb|KEL19329.1| 50S ribosomal protein L10 [Escherichia coli 4-203-08_S3_C1]
 gb|KEL21651.1| 50S ribosomal protein L10 [Escherichia coli 3-373-03_S4_C3]
 gb|KEL21907.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S4_C2]
 gb|KEL31320.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S4_C2]
 gb|KEL38602.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S4_C1]
 gb|KEL46625.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL47333.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S1_C1]
 gb|KEL47851.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S3_C1]
 gb|KEL57642.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S4_C3]
 gb|KEL65251.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S1_C1]
 gb|KEL65744.1| 50S ribosomal protein L10 [Escherichia coli 5-172-05_S1_C3]
 gb|KEL71469.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL77312.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S3_C2]
 gb|KEL88575.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S3_C1]
 gb|KEL89640.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S3_C1]
 gb|KEL97659.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S3_C3]
 gb|KEM00492.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S4_C2]
 gb|KEM03958.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S4_C1]
 gb|KEM11223.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S1_C2]
 gb|KEM18646.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S3_C1]
 gb|KEM22350.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S1_C3]
 gb|KEM26346.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S3_C2]
 gb|KEM26382.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S4_C2]
 gb|KEM37003.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM45307.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S4_C3]
 gb|KEM49102.1| 50S ribosomal protein L10 [Escherichia coli 6-175-07_S1_C3]
 gb|KEM57236.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S3_C3]
 gb|KEM57617.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S4_C3]
 gb|KEM60233.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S1_C2]
 gb|KEM68636.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S3_C1]
 gb|KEM72047.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM80300.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM86220.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S4_C1]
 gb|KEM88984.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S4_C1]
 gb|KEM96615.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S1_C3]
 gb|KEM96832.1| 50S ribosomal protein L10 [Escherichia coli 6-319-05_S1_C1]
 gb|KEM97578.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S3_C3]
 gb|KEN09293.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S4_C2]
 gb|KEN15231.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN20322.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S1_C1]
 gb|KEN21299.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN30730.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S3_C3]
 gb|KEN36844.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S3_C1]
 gb|KEN38088.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S4_C1]
 gb|KEN42426.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S1_C2]
 gb|KEN50287.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN52659.1| 50S ribosomal protein L10 [Escherichia coli 7-233-03_S4_C3]
 gb|KEN61059.1| 50S ribosomal protein L10 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN62714.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN69386.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S3_C2]
 gb|KEN71867.1| 50S ribosomal protein L10 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN82370.1| 50S ribosomal protein L10 [Escherichia coli 2-474-04_S4_C1]
 gb|KEN85289.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S3_C1]
 gb|KEN95027.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S3_C2]
 gb|KEN95796.1| 50S ribosomal protein L10 [Escherichia coli 1-392-07_S4_C1]
 gb|KEO05169.1| 50S ribosomal protein L10 [Escherichia coli 8-415-05_S1_C2]
 gb|KEO06960.1| 50S ribosomal protein L10 [Escherichia coli 2-177-06_S3_C3]
 gb|KEO12240.1| 50S ribosomal protein L10 [Escherichia coli 2-222-05_S4_C3]
 gb|KEO20921.1| 50S ribosomal protein L10 [Escherichia coli 5-366-08_S4_C1]
 gb|KEO25475.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S1_C1]
 gb|KEO28629.1| 50S ribosomal protein L10 [Escherichia coli 1-250-04_S3_C2]
 gb|KEO36175.1| 50S ribosomal protein L10 [Escherichia coli 2-460-02_S1_C2]
 gb|AID81161.1| 50S ribosomal protein L10 [Escherichia coli Nissle 1917]
 gb|KEO95684.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP01477.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP03648.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP12537.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP15459.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP17134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP20600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KEP78705.1| 50S ribosomal protein L10 [Escherichia coli E1140]
 gb|AIF39238.1| 50S ribosomal protein L10 [Escherichia coli KLY]
 gb|AIF62686.1| 50S ribosomal protein L10 [Escherichia coli B7A]
 emb|CDU33435.1| 50S ribosomal protein L10 [Escherichia coli D6-113.11]
 emb|CDU40821.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIF96610.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           SS17]
 gb|AIG71454.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           EDL933]
 gb|KFB90986.1| LSU ribosomal protein L10p (P0) [Escherichia coli DSM 30083 = JCM
           1649 = ATCC 11775]
 gb|KFD78715.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFF39217.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFF54067.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFH75636.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFH88020.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIL17855.1| 50S ribosomal protein L10 [Escherichia coli ATCC 25922]
 gb|AIL38425.1| 50S ribosomal protein L10 [Shigella flexneri 2003036]
 gb|AIL43359.1| 50S ribosomal protein L10 [Shigella flexneri Shi06HN006]
 gb|KFV22376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFV26871.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFV30546.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KFV34977.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CEE10168.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIN34274.1| 50S ribosomal subunit protein L10 [Escherichia coli BW25113]
 gb|KFZ99236.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|KGA86309.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CDY62368.1| 50S ribosomal subunit protein L10, subunit of 50S ribosomal protein
           complex L8 and ribosome [Escherichia coli]
 emb|CDZ22735.1| 50S ribosomal subunit protein L10, subunit of 50S ribosomal protein
           complex L8 and ribosome [Escherichia coli]
 dbj|GAL54226.1| 50S ribosomal protein L10 [Escherichia albertii NBRC 107761]
 gb|KGI46808.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|AIT32778.1| 50S ribosomal protein L10 [Escherichia coli FAP1]
 gb|KGL70061.1| 50S ribosomal subunit protein L10 [Escherichia coli NCTC 50110]
 gb|KGM58636.1| 50S ribosomal protein L10 [Escherichia coli G3/10]
 gb|KGM62882.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGM67251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGM70638.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGM76817.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGM79135.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP09069.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP15780.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP17446.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP38454.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP43184.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGP45925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT05814.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT11185.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT16320.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT20664.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT25780.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KGT30502.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CDX09474.1| 50S ribosomal protein L10,50S ribosomal protein L8,50S ribosomal
           protein L10,Ribosomal protein L10,Ribosomal protein L10
           [Shigella flexneri]
 gb|AIX65982.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHD34224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHD44957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHD47048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHD49002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG71108.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG78571.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG83627.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG84562.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG91826.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHG99074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH00866.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH02936.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH12117.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH13123.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH21725.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH25351.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH27426.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH28917.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH37146.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH41996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH49458.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH51091.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH58750.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH60828.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH67892.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH73164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH73459.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH75188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH88034.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH95354.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH97207.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHH98286.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI07460.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI12796.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI18055.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI18125.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI28453.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI29398.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI33344.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI42173.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI42373.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI52557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI55830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI57107.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI68174.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI71912.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI74240.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI74827.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI86152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI87426.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI93043.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHI93370.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHJ05072.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHJ10739.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHJ17581.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHJ18323.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KHJ19236.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIZ30463.1| 50S ribosomal subunit protein L10 [Escherichia coli ER2796]
 gb|AIZ53787.1| 50S ribosomal subunit protein L10 [Escherichia coli K-12]
 gb|AIZ80622.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIZ85175.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AIZ93244.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AJA29095.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           SS52]
 gb|KHO57310.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CEK08079.1| 50S ribosomal subunit protein L10 [Escherichia coli O26:H11]
 gb|AJB37240.1| 50S ribosomal subunit protein L10 [Escherichia coli APEC IMT5155]
 gb|AJB53982.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CCQ31628.2| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|KIE65172.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIE65306.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIE72119.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIE75514.1| 50S ribosomal protein L10 [Escherichia coli RS218]
 gb|KIG27598.1| 50S ribosomal protein L10 [Escherichia coli C691-71 (14b)]
 gb|KIG30525.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG36236.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG39946.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG41230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG50959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG57410.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG57942.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG63513.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG69140.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG76998.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG80224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG85001.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG93572.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIG93871.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH04798.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH08114.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH11933.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH12135.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH17532.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH19652.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH23438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIH36508.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AJE58540.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KII02623.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AJF58830.1| 50S ribosomal subunit protein L10 [Escherichia coli 1303]
 gb|AJF79102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIN83477.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AJG10976.1| 50S ribosomal subunit protein L10 [Escherichia coli ECC-1470]
 gb|KIO39212.1| 50S ribosomal protein L10 [Escherichia coli O139:H28 str. E24377A]
 gb|AJH12621.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIO86215.1| ribosomal protein L10 [Escherichia coli 97.0264]
 gb|KIQ39390.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIQ44530.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AJM76180.1| 50S ribosomal protein L10 [Escherichia coli RS218]
 gb|AJO86079.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIY25564.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ08876.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ57848.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ60450.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ69735.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ70523.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ77198.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ82250.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ84002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ86588.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KIZ92463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJA02586.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJA07486.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD60403.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD65265.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD75681.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD77505.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD80058.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD86284.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJD90906.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJG96892.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJH00952.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJH04892.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJH98782.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJI12001.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJI24300.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJJ47708.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJJ73091.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|KJJ78843.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|KJW28897.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW32538.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW35845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW43292.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW44704.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW55421.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW56707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW57790.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW66754.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJW72493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KJY08419.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKA93152.1| 50S ribosomal protein L10 [Escherichia coli VR50]
 emb|CQR83371.1| 50S ribosomal subunit protein L10 [Escherichia coli K-12]
 gb|KKA62961.1| ribosomal protein L10 [Escherichia coli 9.1649]
 gb|KKB19085.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KKB20139.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKC13876.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKD59184.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD63564.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD67933.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD72291.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD76653.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD81073.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD85436.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AKD89796.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|KKF76351.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|KKF80344.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|KKJ19681.1| 50S ribosomal protein L10 [Escherichia coli MRSN 10204]
 gb|AKE86536.1| 50S ribosomal protein L10 [Escherichia coli O104:H4 str. C227-11]
 gb|KKJ99947.1| 50S ribosomal protein L10 [Escherichia coli NB8]
 gb|KKK30483.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KKO24276.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KKO24491.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KKO33871.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KKO37546.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKF23174.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKF57706.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AKF61845.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AKF65984.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AKF70124.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AKF74262.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|KKY45057.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AKH24641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLD43839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLD44102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG28694.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG28818.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG38952.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG43076.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG49168.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG49656.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG60922.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG62830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG68746.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG75362.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG80643.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG86546.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG89074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLG96499.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH05224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH06447.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH10490.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH14485.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH22387.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH29008.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH31643.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH39979.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH40628.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH46553.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH55837.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH58352.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH65478.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH66174.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH66223.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH81333.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH83412.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH86198.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLH95619.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKI68972.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|AKK14319.1| 50S ribosomal subunit protein L10 protein [Escherichia coli K-12]
 gb|AKK16075.1| 50S ribosomal subunit protein L10 protein [Escherichia coli K-12]
 gb|AKK50897.1| P pilus assembly protein, pilin FimA [Escherichia coli PCN033]
 gb|AKK35571.1| 50S ribosomal protein L10 [Escherichia coli APEC O18]
 gb|AKK41549.1| 50S ribosomal protein L10 [Escherichia coli APEC O2-211]
 gb|AKK45183.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKK56455.1| 50S ribosomal protein L10 [Shigella flexneri G1663]
 gb|AKM37556.1| 50S ribosomal protein L10 [Escherichia coli PCN061]
 gb|KLU94845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLW99256.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX02298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX10256.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX10499.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX17378.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX23215.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX26548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX30942.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX40789.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX43234.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX50371.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX51604.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX63323.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX66582.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX67613.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX77261.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX80624.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX81283.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX84495.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX90961.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLX96855.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KLY02079.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KME77816.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKN49856.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKO55134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKP86999.1| 50S ribosomal protein L10 [Escherichia coli ACN001]
 emb|CEP56410.1| 50S ribosomal protein L10 [Shigella flexneri 2a]
 gb|KMV38138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KMV43301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KMV46038.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KMV47713.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KMV57205.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KMV61195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKR22766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKR27118.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AKR31619.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNA39039.1| 50S ribosomal protein L10 [Escherichia coli M114]
 emb|CTD21429.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD20995.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD19282.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD09997.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS28631.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD07488.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR62731.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP07931.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ58248.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ68267.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP90774.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP32599.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG47150.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC98059.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP63083.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG35790.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ52691.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE90733.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP85291.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE34268.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC91799.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ44617.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ46389.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN95752.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS04356.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH40652.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP11862.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR48979.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO28659.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ96364.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR15293.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE62800.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE28779.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE76799.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN90815.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE51040.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ10919.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN86284.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ04995.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR71457.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN97178.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP04485.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG36499.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF24587.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF51020.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO21789.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF12752.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ87706.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP35296.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP01141.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ66273.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ98214.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE58615.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ22821.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE80004.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR50033.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC85426.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR43313.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR05704.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ40441.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE82590.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF93427.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE91288.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF87069.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG32163.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST08406.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF01476.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO60689.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE80773.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ31116.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS29088.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE85464.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP51791.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ58315.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO48175.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST61096.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO71965.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF97207.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ94718.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP36023.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG43499.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN81607.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP92676.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR52560.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR26597.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR85869.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM93329.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ78826.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO35513.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN08949.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO92979.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP20434.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE28988.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO03477.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO29558.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP01049.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO12300.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK98666.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST61972.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR74816.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE54788.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF04347.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN47522.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO51814.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP43816.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO86537.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN78375.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP08392.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU11983.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ40256.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO70450.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO89091.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ66611.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST51285.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP53105.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN19146.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF81203.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ20354.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ62246.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP66308.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ93928.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ94377.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR59459.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS87888.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS07805.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ21179.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST20128.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW41938.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO64637.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN01633.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE88806.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL77367.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF15812.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTP70233.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF45385.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU72692.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST05039.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS99324.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW13288.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL57104.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF39306.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF38880.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV95338.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO05029.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL54755.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO86034.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST03058.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ21936.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO57728.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU13536.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE32985.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP95186.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS05735.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST01061.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST89763.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF46123.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO44459.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR65812.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR73208.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV86475.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF71527.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF58625.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG59462.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN46472.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP87598.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO75327.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM25295.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI96326.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW76120.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE34675.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV49896.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC51912.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF16127.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC45811.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX44448.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF47148.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ77762.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA22152.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW66508.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL49431.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR63665.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST23379.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU56439.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTP71252.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR70322.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR54635.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS64510.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF49901.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL80801.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST64899.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS27464.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN51566.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ71437.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL69275.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ00066.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV02987.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST71912.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG95328.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV10625.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV53719.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV25891.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL88495.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW91731.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ05720.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST21422.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX04260.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS06235.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU51439.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR13091.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL32100.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW54196.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR97162.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY23806.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ68632.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO21913.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF30713.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX03942.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV66902.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ56395.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK60421.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS29809.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV26478.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL44362.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU18650.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTP70504.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI74992.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO15046.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW68775.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG91597.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY13192.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK82474.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS71859.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ84837.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL30311.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV64037.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV03800.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ87352.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF64617.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU23436.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX60452.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL33934.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ11118.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX16444.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK77750.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSE54354.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR98639.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN35552.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM02924.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS55840.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV44940.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV78399.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ73635.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY09466.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSQ74845.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK00437.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK90082.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX93475.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI25811.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ28068.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU71795.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ97754.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI91380.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL18029.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB26008.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU39862.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR69012.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM57410.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR46343.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK51506.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU42284.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI72219.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST92204.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL10919.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK72832.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL31978.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS73367.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK86698.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX46239.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU11798.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ13768.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK13389.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX47975.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV72861.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL70373.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX21409.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF99929.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA90498.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV07571.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR83577.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH69691.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR50357.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL19685.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL56728.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST83425.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV12052.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB66221.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ28440.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ87021.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF28076.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK03731.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU79164.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW10087.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY21064.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV81265.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX51058.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI58105.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK33335.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ81741.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY72793.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ78777.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY17187.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF35743.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG53377.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV64513.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM84222.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR13690.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB92783.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC52346.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY63645.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV00795.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ99707.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY98339.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB57839.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW02208.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY30680.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW20128.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM52368.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ68711.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY19781.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSF34151.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ47007.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH00509.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ77073.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST85196.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI84962.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM07989.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD91293.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL90508.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV78223.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ31714.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS74232.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY67787.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG92699.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI67969.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV10279.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM61970.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV18831.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN71345.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS79583.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV67890.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM32594.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH95453.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU98888.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY09370.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY19675.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY51616.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX51577.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ50166.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP03113.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC06495.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO67316.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ60979.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX91598.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM11839.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW77074.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH04401.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB54707.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY19355.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD77837.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV09845.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST83421.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX06878.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU74360.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA13027.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV49408.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSO15330.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR21155.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX34621.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSR08124.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ39746.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH87099.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB60446.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH73437.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX16277.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI06694.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX47332.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY50959.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB87198.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ24799.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH72638.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW99798.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX41623.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM98966.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSP19332.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH90027.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU58298.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK35830.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ68118.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC91926.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV00448.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ34981.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB53782.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU98357.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX50128.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX27215.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI01399.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS34485.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB62665.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS24122.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV23632.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB73302.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI58331.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM51236.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH89641.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ44743.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH26371.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA19579.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM77852.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL76597.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ16854.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK06626.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ62002.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ05495.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM93066.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC11229.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB55989.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTE01734.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC31082.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB58178.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC34856.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSL94825.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX64558.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ87110.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY47667.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH22179.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC03836.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX43372.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU64954.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ66698.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC23602.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH86340.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS34580.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST53286.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM24460.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC63437.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU57157.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU88808.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY64237.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ09103.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX74294.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CST90557.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB36070.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSZ34175.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH09842.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU23196.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC77320.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY29213.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX22889.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH33382.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG79511.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI76446.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH04281.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV01783.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG52834.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK32514.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY80334.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC29523.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM73515.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ61789.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY38779.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ66551.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU67797.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV25589.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG72142.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSU83722.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI19855.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH77293.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSV24484.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSW85198.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSX51375.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH09898.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG69295.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSG63866.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB04596.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA94642.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA00558.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA80964.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA36898.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA30495.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH87450.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI03497.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN15579.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS82306.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH18830.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN22815.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY45426.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH40877.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM04807.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS15302.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM43397.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA54106.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM73012.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM56875.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM39677.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB14102.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH84142.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM11191.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB22213.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM72856.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH79619.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSS58799.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSN02373.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA14767.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM05875.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA72699.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB38685.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA30287.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM74601.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ76280.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ87862.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH67640.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM30938.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSJ41211.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB51646.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSM51488.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB22640.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA56591.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA99347.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH44077.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA63868.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB31181.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA68669.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC36041.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSH51118.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSI42279.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA29206.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA78852.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB08836.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA49710.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTB64059.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTA67713.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK22045.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK10098.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK71879.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTC10432.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK61734.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK68012.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSK32968.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CSY46733.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|KNF11595.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF12959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF16462.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF26202.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF33744.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF39150.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF39159.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF39943.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF51298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF55372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF63976.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF72125.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF72502.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF74668.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF79856.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF89411.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNF93138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG02047.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG03797.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG04745.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG07042.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG18932.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG25927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG31731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG37018.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNG38359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY03372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY53252.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY56009.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY59999.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY69937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY71996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY73892.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY80864.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY83205.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY92819.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY94140.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNY96626.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNZ07044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNZ09809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNZ21883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNZ24714.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KNZ96325.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOA25149.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOA26956.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOA31501.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX25799.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX03942.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR64342.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR65480.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU85882.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU98137.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR80225.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV88441.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS48567.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR59668.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR75996.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW19060.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS27482.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW15088.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT55016.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW10496.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU22646.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU05133.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW16812.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS81001.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU27625.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT79662.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV47074.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS33437.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW34931.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU33947.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW39233.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS67081.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS92301.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW59569.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU00043.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU58255.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS63667.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS54023.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU35607.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS70863.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW66451.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW25255.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT32538.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS90478.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT59753.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS19265.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW10669.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW73040.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW25245.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX08822.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW47390.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS36275.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW00335.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW83208.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR94242.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV86330.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT35857.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT49919.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT32939.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW65930.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW20753.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT26389.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU36534.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW38375.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT39069.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT52175.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV82280.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT58208.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS97427.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU66449.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS93052.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT13598.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS18519.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU89780.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX01375.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT01070.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV91439.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT87685.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW86310.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU30009.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW19751.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU34828.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW81708.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT30790.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW18457.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS81439.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT21022.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT22949.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV73120.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV17496.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV39049.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT77942.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW01520.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW84926.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW68015.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT02285.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT53250.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT45824.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV25195.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT90664.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW76081.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT65311.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW50493.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTR46817.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW23885.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV47483.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT60138.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW53981.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT01081.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT58974.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS46500.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTS19825.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW94172.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW55201.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT01877.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU16390.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV91793.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW42508.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTU06012.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW25906.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT40492.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTV89731.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT29324.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTW76250.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT45009.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTT97214.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY91069.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ33473.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY11929.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY94886.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ59219.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ33371.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY71427.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ14209.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY92894.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ45410.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ84441.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ22099.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ82068.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ58475.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ19782.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ53636.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY25090.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ15458.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX92681.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY87722.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ34962.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY39105.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ20977.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ84089.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ02563.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ28680.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ89659.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY41304.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ70464.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ82917.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ78561.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ71742.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY73927.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ58461.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ55702.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ75985.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ07145.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ96500.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ03983.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY92394.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ31157.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ35650.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ92934.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ94271.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTZ96602.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA16570.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA15590.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA13471.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA16220.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA48181.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA57855.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA51995.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA63550.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA52817.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA50547.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA41333.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA49961.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUA49450.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOR01939.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALB33981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALD27401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALD42171.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALD32457.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALD37231.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUH58203.1| 50S ribosomal subunit protein L10 [Escherichia coli KRX]
 gb|KOZ04168.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ07760.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ16189.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ19222.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ22247.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ27115.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ35738.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ38610.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ49715.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ56534.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ57628.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ60612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ67157.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ73439.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ77759.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ77902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ80291.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KOZ95092.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUK13315.1| 50S ribosomal protein L8 [Achromobacter sp. ATCC35328]
 gb|KPH29222.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPH30559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPH30665.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPH44244.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUQ99259.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 emb|CTY03233.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY12310.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY13997.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX48422.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY10702.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY12577.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX80454.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY21507.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY19200.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY63564.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX35805.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY22000.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX83069.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTD61028.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTD60787.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|CTX56665.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY34247.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTY53608.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX69318.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTX93259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALH93294.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|ALI38355.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|ALI42754.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALI47152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO03173.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO06097.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO08315.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO19818.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO26976.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO35465.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO37447.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO39551.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO44935.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO50833.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO63972.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO64347.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO69864.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO76080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO80224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO82058.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO82627.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO94945.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPO98424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP06686.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP07844.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP14809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP18988.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP24127.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP25015.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP36770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP42454.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP44607.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPP46674.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KPQ49911.1| 50S ribosomal protein L10 [Escherichia coli TW10598]
 gb|KQB24325.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQC23924.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI74083.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI78700.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI83542.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI88500.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI93652.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQI94488.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ03438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ06078.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ12656.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ14224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ19033.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ26959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ29031.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ37088.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ37117.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQJ46682.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALL87809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALL95551.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KQL77550.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KRQ05293.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 dbj|BAT37479.1| 50S ribosomal subunit protein L10 [Escherichia albertii]
 dbj|BAT41702.1| 50S ribosomal subunit protein L10 [Escherichia albertii]
 gb|KRR50067.1| 50S ribosomal protein L10 [Escherichia coli VL2732]
 gb|KRR52104.1| 50S ribosomal protein L10 [Escherichia coli K71]
 gb|KRR54723.1| 50S ribosomal protein L10 [Escherichia coli VL2874]
 gb|ALN48058.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KRT18955.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KRV67807.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KRV96850.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KRV96877.1| 50S ribosomal protein L10 [Escherichia coli]
 dbj|BAT45952.1| 50S ribosomal subunit protein L10 [Escherichia albertii]
 gb|KST27734.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KST34525.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALQ57009.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALQ74457.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSW94932.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSX50182.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSX75815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSX89541.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY04298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY05635.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY21711.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY54559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY66890.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY75576.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY88438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY92552.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSY95643.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KSZ17042.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CRL89815.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|ALT51907.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG76687.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG76789.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG77253.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG89240.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG89298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUG89784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH00862.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH02266.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH04704.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH11873.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH16359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH21269.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH22585.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH28612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUH30070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALV70770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALX54864.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALX60127.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALX64848.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALY15530.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUW83125.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|KUR32340.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUR36997.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ALZ58279.1| LSU ribosomal protein L10p (P0) [Shigella sonnei]
 gb|KUR84531.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUR85521.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUR87423.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUR96583.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS00914.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS07434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS11815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS12344.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS23908.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS25694.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS32017.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS37867.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS40341.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS45557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS53225.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS53812.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS57374.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS66569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS68062.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS75852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS77006.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS83017.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS89576.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS96126.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUS99930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT00359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT07633.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT08266.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT19395.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT20082.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT25317.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT31773.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT37405.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT42760.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT46827.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT48235.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT54737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT65190.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT69202.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT70099.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT73502.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT79776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT85401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT93120.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT96477.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUT96654.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU05539.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU06495.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU12332.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU21901.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU24721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU35048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU38363.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU40107.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU43553.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU46861.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU51567.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU56601.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU63746.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU65971.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU67424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU77349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU81353.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU91221.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU94399.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUU96591.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV05250.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV07963.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV10965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV12992.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV20166.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV28738.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV35019.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV36692.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV43634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV52203.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV54616.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV58080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV62236.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV65335.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV67861.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV72466.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV87081.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV88051.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUV93560.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW01259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW02223.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW09638.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW15023.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW16128.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW18464.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW24753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW28659.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW30559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW38648.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW41565.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW43238.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW55702.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW58755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW59708.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW69026.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW71927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW75089.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW82883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW83067.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW92826.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW94936.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUW99825.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX04695.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX16733.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX19169.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX20443.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX22156.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX29117.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX34408.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX38324.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX43250.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX58642.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX59581.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX60903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX68313.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX71706.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX73852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX81197.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX82483.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX87768.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX92480.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUX98586.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUY00597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KUY09960.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KVI13385.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KVI13521.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KVI23479.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KWV18299.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMB56265.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KWW04088.1| 50S ribosomal protein L10 [Escherichia fergusonii]
 gb|KWW04319.1| 50S ribosomal protein L10 [Escherichia fergusonii]
 gb|KWW07955.1| 50S ribosomal protein L10 [Escherichia fergusonii]
 gb|AMC96845.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|KXC10843.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMG17097.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|AMG80687.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AMH20593.1| 50S ribosomal protein L10 [Escherichia coli B]
 gb|AMH24801.1| 50S ribosomal protein L10 [Escherichia coli B]
 gb|AMH32561.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|AMH37280.1| 50S ribosomal protein L10 [Escherichia coli K-12]
 gb|KXG56134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXG58698.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXG62755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXG69616.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMF89441.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXH00124.1| ribosomal protein L10 [Escherichia coli]
 gb|KXH00718.1| ribosomal protein L10 [Escherichia coli]
 gb|KXH92578.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXI00348.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXI01000.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXI05366.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUW24405.1| 50S ribosomal protein L8 [Escherichia coli]
 gb|AMK99552.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AML07251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AML11903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AML16920.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AML21857.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXK73607.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXK73743.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXK79928.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXK93357.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXK95704.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL05695.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL06399.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL11458.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL17074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL18305.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL31062.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL32981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL35699.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL41201.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL56438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL69149.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL69458.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL73428.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL74821.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL84997.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL87820.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXL91721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM01788.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM05713.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM06636.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM09716.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM20613.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM22985.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM23873.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM49386.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM50445.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM52449.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM56790.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM59451.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM65798.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM74644.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM80771.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM83241.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM84089.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM86025.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXM93923.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN08520.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN14526.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN15270.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN17242.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN19432.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN25829.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN34238.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN34401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN53436.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN53563.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN54809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXN61321.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP15722.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP17350.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP22070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP29585.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP30372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP32228.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP42374.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP47973.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP49944.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP53076.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP63122.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP67446.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP74324.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP74334.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP80230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP83631.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP88522.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP91707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP92053.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXP92645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ05755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ09553.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ12035.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ15440.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ20207.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ26883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ34235.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ39522.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ39610.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ44710.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ50631.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ54097.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ65130.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ65159.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ68965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ71440.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ75119.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ77669.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ87959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ92085.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXQ94316.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR00193.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR03937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR06763.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR16770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR18053.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR19521.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR27736.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR28709.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR41701.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR41898.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR50275.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR54994.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR61534.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR64598.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR67785.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR74453.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR79908.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR85981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR90563.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR94231.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXR98155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMM38962.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMM77016.1| 50S ribosomal protein L10 [Shigella flexneri 1a]
 emb|CUU96275.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AMN60309.1| 50S ribosomal protein L10 [Shigella flexneri 2a]
 gb|AMN65137.1| 50S ribosomal protein L10 [Shigella flexneri 4c]
 gb|KXU67950.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXU73102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KXU74242.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CUX84891.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AMQ53780.1| 50S ribosomal protein L10 [Escherichia coli JJ1887]
 gb|AMR21403.1| 50S ribosomal protein L10 [Shigella sp. PAMC 28760]
 gb|KYL37706.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYN54244.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYN54372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYO62570.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYO64971.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR15743.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR16986.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR18014.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR22893.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR26725.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR33152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR33873.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR37974.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR40580.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR56070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR56570.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR61900.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR67915.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR74057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR76438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR85536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR90114.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYR99204.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS03347.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS07198.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS11815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS15964.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS19392.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS26855.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS28468.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS37849.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS42288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS55839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS56478.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS65014.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS68574.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS76971.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS81724.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS85288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS87663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS87673.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT02035.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT06863.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT07560.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT11521.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT20514.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT21629.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT26259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT33214.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT42926.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT49216.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT57480.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT58937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT61002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT70424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT74078.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT77517.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT80516.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT88688.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT92888.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYT95152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU02461.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU07958.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU08056.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU14006.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU23806.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU24269.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU27128.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU33616.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU40198.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU46375.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU56048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU57425.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU57928.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU66837.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU74734.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU83909.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU85489.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU88019.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYU91910.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV01198.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV02502.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV05015.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV12654.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV17679.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV23105.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV37028.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV38086.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV39784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV47721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV48523.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV51752.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV60840.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV66169.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV68903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV71857.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV77211.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV81254.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV85096.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV93995.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYV99221.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW12414.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW14239.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW15697.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW16507.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW23930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW27860.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW38832.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW38855.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW53746.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW54253.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW61543.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW62724.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW74308.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW76682.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYW81250.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMU84574.1| 50S ribosomal protein L10 [Escherichia coli str. Sanji]
 gb|KYZ91813.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYZ93145.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYZ93955.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMW43814.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMW49233.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMX13352.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMX31555.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMX33871.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AMX42062.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZF29613.1| 50S ribosomal protein L10 [Escherichia coli APEC O2]
 gb|KZG97565.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZG97690.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH07849.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH11794.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH15443.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH19511.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH25138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH35657.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH38683.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH42786.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH47569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH53728.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH54909.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH57125.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH66200.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH68351.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH76285.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH77128.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH79883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH88337.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH94341.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZH98445.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI00247.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI09200.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI09378.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI16657.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI23193.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI24264.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI31364.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI40195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI42499.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI47301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI56245.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI56998.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI61301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI68782.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI73755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI80930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI86132.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI86752.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI91988.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI96478.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZI99954.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ04746.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ12693.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ12991.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ13925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ26348.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ29163.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ33918.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ37895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ43421.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ51783.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ56337.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ64729.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ65331.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ68675.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ71573.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ78678.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ86907.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ91740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZJ92663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZK02436.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO60868.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO64856.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO69767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO73884.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO76698.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO81842.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZO82497.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZP36115.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZP43449.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KZP43657.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAC00893.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC01266.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC09094.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC10291.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC18720.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC21126.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC28715.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC31934.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC38151.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAC39484.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OAE52491.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAE68752.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF23538.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF31749.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF32264.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF36134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF42116.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF47600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF51536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAF90228.1| 50S ribosomal protein L10 [Escherichia coli PCN009]
 gb|OAF90521.1| 50S ribosomal protein L10 [Escherichia coli PCN079]
 gb|OAI33521.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANE60291.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANE65048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAJ80059.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAJ84627.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAM50598.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SAP96576.1| 50S ribosomal protein L10 [Klebsiella oxytoca]
 gb|OAN06644.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OAO37416.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO42833.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO42877.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO52195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO57224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO62655.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO70973.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANG71479.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|ANG76978.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|ANG82658.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OAP72959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAR86340.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAR88143.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAS05852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAS90654.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAT65629.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAV57253.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANJ37344.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANJ40499.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAY14910.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANK04543.1| rplJ [Escherichia coli O25b:H4]
 gb|ANK11175.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTQ84604.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|ANK51166.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANM84793.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANK34807.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OBU89970.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANO91937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANP10002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANP20824.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANP30648.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANO80527.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANQ03351.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANO27442.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANR83809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OBZ44771.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OBZ46489.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OBZ47758.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCC35226.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC36555.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC40758.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC53590.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC53860.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC54521.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC63312.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC64304.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC64889.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC72319.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC79454.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC79666.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC82891.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC83104.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC89566.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCC97462.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD05723.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD06456.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD11081.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD13502.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD19527.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD24303.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD24737.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD29133.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD33069.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD46820.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD47184.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD47548.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD54563.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD58239.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD61435.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD63019.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD68846.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD72432.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD75032.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD83188.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD90580.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD93982.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD94679.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCD99253.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE00647.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE10071.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE16719.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE16995.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE19112.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE33472.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE34930.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE35805.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE37350.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE45850.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE46035.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE49190.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE52963.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE54003.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE69438.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE71923.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE75146.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE76504.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE77805.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE77967.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE86616.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE89572.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCE97974.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCF02725.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCF09053.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCF11273.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCF13979.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OCF19093.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SCA73851.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCJ84805.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCJ89620.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCJ94794.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCJ97816.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCK02419.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANV95364.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCK71592.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANW29319.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ANW42959.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OCO33993.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCQ10639.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCQ24130.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCQ31925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCQ46841.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS57814.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS62027.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS63253.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS70747.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS76142.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCS77949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCT06504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCW51185.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OCW81217.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOD08869.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODA86161.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODB45429.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODB51470.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODG71406.1| 50S ribosomal protein L10 [Shigella sp. FC1661]
 gb|ODG72788.1| 50S ribosomal protein L10 [Shigella sp. FC2045]
 gb|ODG79695.1| 50S ribosomal protein L10 [Shigella sp. FC2928]
 gb|ODG84253.1| 50S ribosomal protein L10 [Shigella sp. FC1882]
 gb|ODG85125.1| 50S ribosomal protein L10 [Shigella sp. FC1764]
 gb|ODH14463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODH20569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODH27062.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODH30598.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODH38902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODJ19288.1| 50S ribosomal protein L10 [Shigella sp. FC1180]
 gb|ODJ19909.1| 50S ribosomal protein L10 [Shigella sp. FC1172]
 gb|ODJ31570.1| 50S ribosomal protein L10 [Shigella sp. FC2833]
 gb|ODJ32425.1| 50S ribosomal protein L10 [Shigella sp. FC2383]
 gb|ODJ35174.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODJ38764.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOM48748.1| LSU ribosomal protein L10p [Escherichia coli]
 gb|AOM55422.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOM60456.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOM72529.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODQ11797.1| 50S ribosomal protein L10 [Shigella sp. FC1544]
 gb|ODQ16177.1| 50S ribosomal protein L10 [Shigella sp. FC1139]
 gb|ODQ16769.1| 50S ribosomal protein L10 [Shigella sp. FC1056]
 gb|AOO72160.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEB95803.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEG26029.1| 50S ribosomal protein L10 [Shigella sp. FC2117]
 gb|OEG30005.1| 50S ribosomal protein L10 [Shigella sp. FC2175]
 gb|OEG30450.1| 50S ribosomal protein L10 [Shigella sp. FC2125]
 gb|OEG42115.1| 50S ribosomal protein L10 [Shigella sp. FC2710]
 gb|OEG42707.1| 50S ribosomal protein L10 [Shigella sp. FC2531]
 gb|OEG43418.1| 50S ribosomal protein L10 [Shigella sp. FC2541]
 gb|OEG51657.1| 50S ribosomal protein L10 [Shigella sp. FC3196]
 gb|OEG65587.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOR17966.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI00720.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI02666.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI05753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI16737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI17027.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI25214.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI28369.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI30133.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI31751.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI43548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI46109.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI58347.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI58436.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI66212.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEI98234.1| 50S ribosomal protein L10 [Shigella sp. FC1567]
 gb|OEI99302.1| 50S ribosomal protein L10 [Shigella sp. FC1708]
 gb|OEJ03304.1| 50S ribosomal protein L10 [Shigella sp. FC1737]
 gb|OEL39874.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL42417.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL49767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL51229.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL54333.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL64406.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL65149.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL69129.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL75917.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL77329.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL81491.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL91557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL94292.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEL97891.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM06831.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM14978.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM16060.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM16995.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM24706.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM26751.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM31506.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM35982.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM46095.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM47344.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM52245.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM63587.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM64829.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM66514.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM73980.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM79768.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM81885.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM88606.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM90481.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEM97869.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN01367.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN07231.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN09456.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN09705.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN20834.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN27645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN32594.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN37163.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN45098.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN45895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN51417.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN55388.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN61006.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN66681.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN70463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN72115.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN75392.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN79895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN90493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEN90888.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEO00766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEO02414.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEO04053.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEO13230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OEO19082.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOT34985.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|AOV24076.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV29429.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV34793.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV40198.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV45557.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV50954.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|AOV56324.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OFE24612.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SDP10439.1| LSU ribosomal protein L10P [Shigella sonnei]
 gb|AOX54713.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AOX60105.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OHV06481.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OHW34680.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SER26767.1| LSU ribosomal protein L10P [Escherichia coli]
 gb|APA23946.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII46759.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII51675.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APA39543.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII79452.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII80178.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII83972.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII96610.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OII99441.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIJ02718.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SCQ12298.1| 50S ribosomal protein L8 [Escherichia coli]
 gb|OIU79373.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIU80468.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APC53453.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           W3110]
 gb|OIY22771.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY26731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY36059.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY39887.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY42707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY49041.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY54431.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY61450.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY70658.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY74212.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY74262.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY81224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY82369.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY96860.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY99044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIY99993.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ02221.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ03856.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ10757.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ25810.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ26917.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ29861.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ59316.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ74730.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ87539.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ88781.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OIZ99164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF20074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF22386.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF22543.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF35517.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF37572.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF46004.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF51949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF52041.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF62758.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJF86281.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SHD58546.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|APE55705.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APE60655.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APE65535.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APE70370.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APE82240.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|APE94198.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|OJH21298.1| 50S ribosomal protein L10 [Escherichia coli NA114]
 gb|APG34168.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API01107.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API06725.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API12301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API17865.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API23509.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API28998.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API34674.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API40235.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|API45291.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK11389.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK17740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK21959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK22663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK30084.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK30886.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK32233.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK45790.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK54935.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK58166.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK63245.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK71023.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK72246.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK76291.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK81652.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK85960.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK89991.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJK98896.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL00933.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL02852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL13339.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL15870.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL24726.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL29082.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL34138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL40220.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL46815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL50206.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL59369.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL62285.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL62742.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL71459.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL79864.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL81093.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL85568.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL91656.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJL91713.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM01903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM06391.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM11778.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM13577.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM14641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM28288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM29034.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM38894.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM47116.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM49766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM56976.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM58540.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM61953.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM69577.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM73004.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM82195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM82510.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM82889.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJM83502.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN00304.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN02433.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN02764.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN13890.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN16810.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN26674.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN28056.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN36721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN42953.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN43326.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN53053.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN53358.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN54296.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN68039.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN71093.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN75010.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN80177.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN86246.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN91899.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJN92740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO07938.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO07965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO12945.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO14614.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO22612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO28806.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO31640.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO32027.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO42029.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO47230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO49295.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO56027.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO62767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO65271.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO69857.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO76281.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO84630.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO85081.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO91151.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJO97015.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP02435.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP03634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP11090.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP14268.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP26322.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP26342.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP27995.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP32475.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP42901.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP45248.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP52913.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP56541.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP61385.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP65957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP66963.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP74218.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP80983.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP85321.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP93333.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJP96512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ02514.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ07002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ10331.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ17252.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ17960.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ23724.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ29650.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ30195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ41026.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ44743.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ50261.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ53341.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ59022.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ59957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ65046.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ70470.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ71952.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ83439.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ85353.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ85401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ95004.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJQ96675.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR03835.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR11566.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR13071.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR20467.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR28737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR34845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR35046.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR42227.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR45394.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR48953.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR59434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR62080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR66707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR72699.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR78031.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR84005.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR88552.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR93375.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJR94432.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS00730.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS09481.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS16181.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS18405.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS19756.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS24999.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS33094.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS33470.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS44468.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS44708.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS54446.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS54776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS64083.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS71219.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS72028.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS80740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJS87597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OJZ28534.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ56434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ63208.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ66040.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ74572.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ79376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ84575.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ88929.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ90503.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APJ95882.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK01225.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK08288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK13264.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK17895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK21671.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK24815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK29642.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK35833.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK37322.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK45790.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK49121.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK55306.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK56272.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK61371.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK68761.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK71482.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK74342.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK82247.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK83968.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK91190.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK94890.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APK98641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL05738.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL07896.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL15843.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL19146.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL24727.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL30672.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL34039.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL39285.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL44671.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL49102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL57960.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL62186.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL68663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL72712.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL74925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL80320.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL84299.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL89644.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APL51133.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKA61490.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKB69753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKB72734.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKB85246.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKB90476.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKB93286.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKL78620.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKL98040.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKO61043.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKP61557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKS72667.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKS91930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKS94439.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT03216.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT05295.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT21284.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT22279.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT22991.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT29681.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT30797.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT46371.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT47524.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT51894.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT58468.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT61362.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT70495.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT72759.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT73524.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT83987.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT86836.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT92419.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKT96374.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU02781.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU11321.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU14905.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU15817.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU22143.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU24244.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU37372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU39631.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU44909.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU48268.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU51612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU66177.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU68851.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU69408.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU70829.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU72302.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU88534.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU90551.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU95359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKU97010.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV09650.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV09790.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV21119.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV29303.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV35959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV43022.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV45273.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV55607.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV56288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV59672.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV67903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV68255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV80549.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV88486.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV90975.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV91817.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKV94358.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW06420.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW06894.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW11119.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW22040.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW24889.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW26537.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW29098.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW35474.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW43338.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW50394.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW65751.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW72545.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW73100.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW74754.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW77455.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW77588.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW90385.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW96950.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKW99224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX08185.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX15705.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX23898.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX24847.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX26068.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX33944.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX43925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX45033.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX49955.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX52013.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX56912.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX64360.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OKX75194.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APQ23640.1| 50S ribosomal protein L8 [Escherichia coli]
 gb|OLL61456.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APT05044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLN77068.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLO94784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APT64644.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLR29999.1| 50S ribosomal protein L10 [Escherichia coli O25b:H4-ST131]
 gb|OLR88318.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS67947.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS70057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS76855.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS82876.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS83354.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLS87400.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLT07932.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLY55846.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OLY89070.1| 50S ribosomal protein L10 [Escherichia coli O157:H43]
 gb|OMG98776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OMH04215.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OMH07259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|APW93116.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OMI43478.1| 50S ribosomal protein L10 [Escherichia coli N37058PS]
 gb|OMI48317.1| 50S ribosomal protein L10 [Escherichia coli N40607]
 gb|OMI52646.1| 50S ribosomal protein L10 [Escherichia coli N37122PS]
 gb|OMI54851.1| 50S ribosomal protein L10 [Escherichia coli N40513]
 gb|OMI61022.1| 50S ribosomal protein L10 [Escherichia coli N37139PS]
 gb|OMI67569.1| 50S ribosomal protein L10 [Escherichia coli N36254PS]
 gb|OMI69163.1| 50S ribosomal protein L10 [Escherichia coli N36410PS]
 emb|SIX62733.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX34287.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC67979.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC36184.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB44753.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC54845.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX82953.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ68451.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX87973.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH56063.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC51836.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB55872.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC60280.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC70758.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX37088.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB27356.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC04748.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC60059.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC24862.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB86128.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX60452.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB70552.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB42254.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX45848.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI39466.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX53658.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH19200.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA92531.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI06968.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB17365.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH62814.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX39314.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH64937.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB43464.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB18954.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB62353.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB68778.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB52546.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB78414.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI18216.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC57523.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB60471.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI22418.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX51548.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB91536.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ45663.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW97596.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX48274.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX33730.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX09884.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX07504.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ21661.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI15126.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX32610.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA20045.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA52348.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ68558.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD26737.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX43485.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA27953.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG21319.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI00676.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF83667.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI05664.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW72748.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB35689.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH69593.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI19349.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG98484.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW84654.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB13846.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG01217.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI05897.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC74950.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC38677.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB83997.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG49243.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ81587.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH09157.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH00315.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ47414.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK08345.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA34362.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX32507.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG25936.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ77665.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ04803.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA41229.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG51719.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG40775.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY83899.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ07444.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK44464.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA56185.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB61446.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ01736.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB38835.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE96977.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX76308.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX37560.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA07462.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA44559.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH53659.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI85493.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX45805.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA29792.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX70033.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI21209.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ41854.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK14336.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX36009.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA78414.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH33195.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ94521.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG71341.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK10678.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY54001.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX39985.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI54814.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA71383.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK54758.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK36813.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY94931.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX56163.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ37025.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ02829.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX35500.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI27741.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI39678.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI57813.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX23959.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ75081.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ40096.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI57567.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX85382.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG08882.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY70680.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA96439.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ52087.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB44113.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY05353.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC50080.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY83161.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI37682.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH43545.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ78099.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY30175.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK41147.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI42854.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX29373.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ23464.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ70050.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ65596.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ55818.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW76673.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX67966.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI38965.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI83258.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB40229.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ73547.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ13168.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG90566.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF96505.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI39069.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA95663.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB20198.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX25990.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ52432.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ45003.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY01844.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX08341.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG54141.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX05402.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI93372.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ35480.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA01949.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG29267.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG83522.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ10073.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY97808.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK19553.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH77237.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB19725.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ52117.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW79953.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX92402.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE25442.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ04807.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY70560.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ12728.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK40353.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF36360.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA45344.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ02770.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA79263.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI66858.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI41829.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ52457.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX02112.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ63834.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ34523.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG47552.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA51390.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ07188.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG63536.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ10039.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH71571.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ41895.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG13156.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA82403.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB49354.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB79379.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ24590.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF12251.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ02425.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK11336.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG21765.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF27880.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD27851.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF12542.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA77781.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF31833.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG29578.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJA61047.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ97699.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ16506.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC28727.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF33639.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF22195.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC28735.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ93964.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG21585.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ20142.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ59466.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG14484.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG52735.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF15392.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB49874.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJJ94106.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX14989.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG84122.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE63904.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF03726.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF08493.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG16020.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF86174.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJB35157.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG45964.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK55756.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX68321.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD55813.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIW68762.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC29056.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIY15593.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF26763.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX64987.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD69686.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG32466.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF11635.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF90826.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG47589.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ15519.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJI45208.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG45720.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD84565.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ54611.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC96297.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJH01115.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD77108.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF79332.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE74166.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD79384.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD68047.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE53572.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG60290.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIX33663.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF81541.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK41939.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK11772.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SIZ30910.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG28382.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK20945.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD62423.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD91568.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD44043.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE45374.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC64681.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD20850.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJC31545.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD50064.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE65145.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJG18503.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD23883.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD80812.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD70873.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF38910.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE32041.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJF80953.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD76460.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE59369.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD39512.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE45591.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD38190.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE22336.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD87909.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE42058.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD53839.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJK15854.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE00975.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD26230.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD53666.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD27836.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE54779.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJD33939.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE12530.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJE35594.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ONF87312.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONG15557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONG19544.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONG22651.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONG23308.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONG28281.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SJK90956.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|ONK34055.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONK35876.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ONK50284.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SJM00448.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJL89134.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJL99878.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJM01818.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJL99614.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SJL98560.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ONN29033.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SJM22844.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OOC67874.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOC68376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOC76519.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOD57075.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQP93890.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOG28905.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOH57677.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOH59812.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOH62963.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOH98556.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI11593.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI13989.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI16184.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI26975.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI27824.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI34114.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI41101.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI43273.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI48512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI51850.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI60224.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI66226.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI66647.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI74251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI76797.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI85320.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI86319.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOI94769.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ00677.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ02812.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ06935.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ14442.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ22897.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ24634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ27395.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ28850.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ39220.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ45413.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ45613.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ54615.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ55635.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ65071.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ67902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ68349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ79115.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ81618.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ90255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ93091.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOJ98680.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK01044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK09548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK09575.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK18937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK26883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK29439.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK30932.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOK47492.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOM83185.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OON49603.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OON72843.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQU01755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQU95163.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOO81150.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OOO82271.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OOO82863.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OOO90140.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|OOO93336.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|OOO94171.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|OOP04722.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP07111.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP10231.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP16368.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP21213.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP21397.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP27574.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP28471.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OOP34758.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OOP37993.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|AQV22651.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV25970.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV30119.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV35396.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV39870.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV48536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV53295.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV57339.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV64314.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV68595.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV74447.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV80858.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV85546.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQV88458.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQW04316.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQW06830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQW11544.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQW19483.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOV67237.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOW14305.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOW18809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OOW30927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQW75685.1| 50S ribosomal protein L10 [Escherichia coli M8]
 gb|AQX99273.1| 50S ribosomal protein L10 [Escherichia coli NU14]
 gb|OPH57372.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OPH64455.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OPH69251.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OPI30454.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI30774.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI37044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI46767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI47505.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI60963.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI61958.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI70482.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI71443.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI74071.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI82949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI85819.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI87504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI88106.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPI99849.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ08902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ09289.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ19935.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ24271.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ26299.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ28233.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ32721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ42104.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ43292.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OPJ52766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQZ28199.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQZ79819.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AQZ88577.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA05041.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA05748.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA17632.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA31776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA36804.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARA66188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OQK69012.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ARD53742.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARD79295.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARD83161.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARE49509.1| 50S ribosomal protein L10 [Escherichia coli C]
 dbj|BAX13453.1| 50S ribosomal protein L10 [Escherichia coli]
 dbj|BAX18624.1| 50S ribosomal protein L10 [Escherichia coli]
 dbj|BAX23504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORC94785.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORC95418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD00011.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD10881.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD17158.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD25385.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD31008.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD34403.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD34939.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD49641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD60796.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD64109.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD69444.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD83230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD85763.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORD88984.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORE72764.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORE74017.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARH99645.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|ORJ73401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORR78145.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORR78183.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORR86798.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORR89570.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORR90284.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS01338.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS02364.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS04764.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS14817.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS16736.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS17631.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS28346.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS29729.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS30830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS40728.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS48406.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS57847.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS58368.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS64312.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS66647.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS70391.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS70997.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS80107.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS86438.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS86468.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS97717.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORS98581.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT01315.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT12288.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT14466.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT14849.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT27077.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT29899.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT37080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ORT42069.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SMB36473.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 emb|SMB36471.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|OSB91425.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSB92075.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSC10164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSC11108.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSC15725.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SMH61900.1| LSU ribosomal protein L10P [Escherichia coli]
 gb|ARJ98247.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSK01360.1| 50S ribosomal subunit protein L10 [Escherichia coli SHECO001]
 gb|OSK08104.1| hypothetical protein EAOG_05113 [Escherichia coli R527]
 gb|OSK09246.1| 50S ribosomal protein L10 [Escherichia coli FVEC1465]
 gb|OSK18143.1| 50S ribosomal protein L10 [Escherichia coli M056]
 gb|OSK20443.1| 50S ribosomal protein L10 [Escherichia coli TA144]
 gb|OSK22466.1| ribosomal protein L10 [Escherichia coli B574]
 gb|OSK33819.1| 50S ribosomal protein L10 [Escherichia coli E267]
 gb|OSK34206.1| ribosomal protein L10 [Escherichia coli B671]
 gb|OSK36759.1| ribosomal protein L10 [Escherichia coli B108]
 gb|OSK47048.1| 50S ribosomal protein L10 [Escherichia coli H588]
 gb|OSK48711.1| 50S ribosomal protein L10 [Escherichia coli H413]
 gb|OSK57912.1| ribosomal protein L10 [Escherichia coli B921]
 gb|OSK58854.1| 50S ribosomal protein L10 [Escherichia coli E560]
 gb|OSK60067.1| 50S ribosomal protein L10 [Escherichia coli E1114]
 gb|OSK70387.1| 50S ribosomal protein L10 [Escherichia coli H223]
 gb|OSK72373.1| 50S ribosomal protein L10 [Escherichia coli H001]
 gb|OSK81282.1| 50S ribosomal protein L10 [Escherichia coli H378]
 gb|OSK82098.1| ribosomal protein L10 [Escherichia coli B367]
 gb|OSK88428.1| 50S ribosomal protein L10 [Escherichia coli TA447]
 gb|OSK94750.1| 50S ribosomal protein L10 [Escherichia coli E1002]
 gb|OSL01250.1| 50S ribosomal protein L10 [Escherichia coli H386]
 gb|OSL02833.1| 50S ribosomal protein L10 [Escherichia coli H296]
 gb|OSL08125.1| 50S ribosomal protein L10 [Escherichia coli H305]
 gb|OSL15393.1| ribosomal protein L10 [Escherichia coli B175]
 gb|OSL21133.1| 50S ribosomal protein L10 [Escherichia coli TA255]
 gb|OSL22980.1| 50S ribosomal protein L10 [Escherichia coli H617]
 gb|OSL27594.1| ribosomal protein L10 [Escherichia albertii B156]
 gb|OSL31102.1| 50S ribosomal protein L10 [Escherichia coli TA464]
 gb|OSL40789.1| 50S ribosomal protein L10 [Escherichia coli H461]
 gb|OSL43063.1| 50S ribosomal protein L10 [Escherichia coli H605]
 gb|OSL51429.1| 50S ribosomal protein L10 [Escherichia coli H454]
 gb|OSL51467.1| 50S ribosomal protein L10 [Escherichia coli H383]
 gb|OSL56319.1| 50S ribosomal protein L10 [Escherichia coli H420]
 gb|OSL67082.1| 50S ribosomal protein L10 [Escherichia coli TA008]
 gb|OSL67125.1| 50S ribosomal protein L10 [Escherichia coli TA054]
 gb|OSL70919.1| 50S ribosomal protein L10 [Escherichia coli TA014]
 gb|OSL81095.1| 50S ribosomal protein L10 [Escherichia coli TA249]
 gb|OSL84511.1| 50S ribosomal protein L10 [Escherichia coli E704]
 gb|OSL84547.1| 50S ribosomal protein L10 [Escherichia coli T426]
 gb|OSL95701.1| 50S ribosomal protein L10 [Escherichia coli E1118]
 gb|OSL96459.1| 50S ribosomal protein L10 [Escherichia coli R424]
 gb|OSM84054.1| 50S ribosomal subunit protein L10 [Escherichia coli SHECO003]
 gb|OSM89685.1| 50S ribosomal subunit protein L10 [Escherichia coli SHECO002]
 gb|OSP31059.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARM40648.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSQ35274.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARM77382.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OSY86061.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARQ23827.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTA13707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB22124.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB25942.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB31768.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB34869.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB40893.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB44700.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB50528.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB51472.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB60728.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB68083.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB70673.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB75529.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB80966.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB88427.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB94340.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTB97085.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC00305.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC09784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC10251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC19757.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC24588.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC31435.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC33174.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC36926.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC46349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC46548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC53360.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC62088.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC68147.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC69762.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC76493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC84142.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC84189.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC94941.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTC97234.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD04703.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD06303.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD15923.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD19080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD24923.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD31056.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD32310.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD34698.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD46641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD48858.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD57042.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD60881.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD64665.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD69373.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD77912.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD78584.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD88216.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD89059.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTD96164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE05236.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE05548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE14923.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE18781.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE21309.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE28844.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE33600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE39432.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE46381.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE46777.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE56912.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE62681.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE63603.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE73359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE76292.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE84306.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTE90307.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARR32699.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARR41539.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ARR58709.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARR66495.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTU95477.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV02676.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV03676.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV11809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV16835.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV17740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV37215.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OTV43351.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUD11549.1| 50S ribosomal protein L10 [Escherichia coli M4]
 gb|ARS06198.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OUF53222.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF65124.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF68373.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF71423.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF79435.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF81968.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF86329.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF94592.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF96126.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUF99028.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG05909.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG12451.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG14767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG21160.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG21601.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG24200.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUG32773.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUJ66076.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUJ69037.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUJ78984.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUJ87178.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK53880.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK56466.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK71171.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK83830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK95180.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUK98782.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUL12910.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ART19349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ART27131.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ART41604.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|OUP37191.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUR46578.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUR49763.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUR52373.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARV30076.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARV34927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARV49283.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARV55804.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OUZ46819.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ47403.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ52868.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ59543.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OUZ63659.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ67163.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OUZ72526.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ76020.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ82318.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ87269.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ89688.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OUZ95385.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OUZ98579.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OVA39561.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA40852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA41951.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA54212.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA55993.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA62950.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA69720.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA73646.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA75794.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA87157.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA90190.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVA99978.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB04379.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB05857.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB08396.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB18675.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB19463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB22356.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB35065.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB39394.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB42756.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB51192.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB57591.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB59264.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB65303.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB71607.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB78737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB89118.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB89303.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVB98876.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC00600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC06452.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC09844.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC18976.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC20980.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC28961.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC31110.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC36928.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC40399.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC51695.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC54724.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC56072.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC65613.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC70612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC73874.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC77968.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC87561.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC89401.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVC95670.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD05905.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD06650.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD14589.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD23507.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD25267.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD29772.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD35843.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD43129.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD48461.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD48690.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD53255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD65676.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD68645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD73756.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD77354.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD79359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD89486.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD93340.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVD94798.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVE14070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVE25157.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVE26888.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARW85980.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARW90254.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARX16193.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARX24059.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARX28028.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARX58645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVF97971.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVG49278.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVJ50013.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OVY44493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWB93613.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWB95559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWB99151.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC02711.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC10549.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC15164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC19784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC24724.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC28509.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC39981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC40846.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC44074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC47167.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC53634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC58899.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC61045.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC67569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC71604.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC74335.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC80155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC84444.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC88451.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC95305.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC98315.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC99937.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWC99947.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD16026.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD18518.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD25446.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD28674.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD28732.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD36510.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD39369.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD42260.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD50256.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD54313.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD59477.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD62196.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD71622.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD74893.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD75430.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD82093.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD86575.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD96033.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWD99832.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE02098.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE03900.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE11755.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE20098.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE23807.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE27016.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE29710.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE36616.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE38378.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE44624.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE49378.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE49415.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE58645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE64322.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE66675.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE73395.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE78363.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE82804.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE87643.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWE98063.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF00669.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF01974.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF08461.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF11541.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF22455.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF23669.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWF27145.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARZ83694.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ARZ88323.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASA44929.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG40789.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG41593.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG48557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG53974.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG56481.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG60859.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG70253.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG71484.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG72102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG83501.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG86203.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG94668.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG97951.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWG98953.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWH09209.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWH09970.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWH10070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWH23297.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASA59969.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASA67949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASB77888.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASC17164.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWP99562.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWR13710.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OWR37633.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWS81637.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWS83620.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASE47626.1| 50S ribosomal protein L10 [Escherichia coli O157]
 gb|ASF04888.1| 50S ribosomal protein L10 [Escherichia coli O104:H4]
 gb|ASG51839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWW50541.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWW55895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWX78817.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWX79410.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWX89241.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OWY50456.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASI18504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASI53331.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|ASJ28277.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASJ36371.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASJ45835.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXB30189.1| 50S ribosomal protein L10 [Shigella flexneri 2a str. 301]
 gb|ASL29347.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASL62071.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|OXJ45143.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ45670.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ54779.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ61425.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ64445.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ67636.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ72386.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ78125.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ82963.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ91538.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ94137.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXJ98548.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK03673.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK06891.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK15067.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK18522.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK24985.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK26831.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK34638.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK38677.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK45395.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK50243.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK54955.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK60383.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK65418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK66218.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK66727.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK80570.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK82357.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK88691.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK91772.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXK97054.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASN31558.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ASN36107.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ASN42591.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXL46432.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL58433.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL62503.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL64664.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL69418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL70347.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXL78903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASO02421.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASO81443.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASO85897.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASO95457.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXU87408.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXU90155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASQ55448.1| 50S ribosomal protein L10 [Shigella flexneri 4c]
 gb|ASQ59257.1| 50S ribosomal protein L10 [Shigella flexneri 4c]
 gb|ASQ61206.1| 50S ribosomal protein L10 [Shigella flexneri 1a]
 gb|ASQ69610.1| 50S ribosomal subunit protein L10 [Escherichia coli NCCP15648]
 gb|ASQ79908.1| 50S ribosomal protein L10 [Shigella flexneri 1a]
 gb|OXV12808.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXV23701.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXV30485.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXV39204.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXV45370.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXW58498.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXW63413.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXW66917.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXW72220.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXW76692.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXW80876.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXW85676.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXW92110.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OXW94347.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXX00141.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXX04758.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXX08770.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXX12968.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|OXX17330.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OXZ48086.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ51586.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ52522.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ63704.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ67615.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ68095.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ69033.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ80551.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ80725.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ84815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ94434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ97836.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OXZ98575.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA09661.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA13297.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA13393.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA23314.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA30325.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA31638.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA36334.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA39662.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA44473.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA49493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA50737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA52129.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA62178.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA74057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA75397.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA80206.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA82023.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA89593.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA95093.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYA98433.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB01352.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB05082.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB07191.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB15265.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB19148.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB24377.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB33066.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB33097.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB37747.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB45525.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB45772.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB49383.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB60230.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB61516.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB69436.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB72297.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB72327.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB78183.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB90152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB92189.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB94512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB97376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYB99884.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC11574.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC13514.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC18013.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC26237.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC28996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC34856.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC44717.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC46729.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC50219.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC52824.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC54111.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC63903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC67200.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC71637.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC75655.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYC77036.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYD28905.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYE11256.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYE13333.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYE48935.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYE62242.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYE63626.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYE86132.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYF32176.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYF61992.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYF72859.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYF92576.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG13306.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG55234.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG67290.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYG69724.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYG78134.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG80612.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG86226.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG91700.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYG96982.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI00152.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI11548.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI12632.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI25193.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI40570.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI42588.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI46401.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYI52443.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI56334.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI62154.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI65311.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI72936.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI78775.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI83148.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYI86107.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYJ13388.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYJ17923.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ21281.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ34842.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ37315.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYJ47967.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYJ51426.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ51888.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ59973.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYJ70268.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYJ73518.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYJ78449.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK21854.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK24185.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK24214.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK32763.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYK43809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYK49583.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYK52040.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK57190.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK63942.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK65152.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYK75853.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYK78380.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYL18714.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL26028.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL32557.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYL33802.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL44349.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL47639.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYL56854.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL67337.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYL75089.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYL83142.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|OYN25559.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|OYN41149.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYN42989.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYN69278.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AST63522.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OYQ60800.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SNW15957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZC25024.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZG35426.1| 50S ribosomal protein L10 [Escherichia coli O157:H7]
 gb|OZM85731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZM89769.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZM95839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZN01006.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZN04918.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO57421.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO62137.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO67286.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO72241.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO77191.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO82227.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO87054.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO91925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO96700.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP01527.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP06558.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP11376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP16515.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP21338.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP25709.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZP31066.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZR90725.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZR95961.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZS00596.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZS05597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZS10659.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX62286.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX67938.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX71293.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX77301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX83838.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX87914.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX91397.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZX96063.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZY04580.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZY06951.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZY15350.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZY16371.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZY23982.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB66039.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB75748.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB78634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB87899.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB92267.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB92602.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAB99911.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAC19858.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAL28981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAL33355.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAL34252.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAL43227.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAL47852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ18922.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ27374.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ27617.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ31700.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ32923.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ43182.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ47803.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ51134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ56807.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ59843.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ72303.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ73772.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ83656.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ85357.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ92380.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAQ93318.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAR01529.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS47179.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS47795.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS50632.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS59541.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS65481.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS70702.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS75410.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS76796.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAS82166.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|CTP98452.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|ASW62271.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|ASX08397.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAT79111.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAT80047.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAT87760.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAT96480.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAT99506.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU06333.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU09803.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU11511.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU13053.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU24679.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAU30386.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAX41057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAX46688.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAX53530.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASZ43949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ASZ48434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAY68476.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PAY69571.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PAY74999.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PAY81992.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PAY82066.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PAY84497.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PAY95296.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PAZ26784.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ31821.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ38776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ41911.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ47363.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ49155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ55731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ60466.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ65269.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ72286.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ73362.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ80568.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ84218.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ93434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PAZ95816.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB10985.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB16144.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK06555.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK11510.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK17037.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK21459.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK27597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK31975.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK38552.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBK42370.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB75285.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB80562.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB85079.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB90232.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB95120.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATC04710.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATC05797.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATC14619.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATC19485.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN52273.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN57420.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN64568.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN67885.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN71851.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN80332.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN82441.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBN87237.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO12115.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PBO42022.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO43071.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO45020.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO59030.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO60639.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO66140.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO72508.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO72752.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBO88336.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PBO91844.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PBO98513.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBP01756.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PBP11662.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PBQ36677.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ40259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ45114.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ50783.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ55766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ60545.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ65919.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ70993.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ75949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ81106.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ86419.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ91390.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ96533.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBQ98770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR07068.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR10349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR21012.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR22815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR28352.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR33311.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR39635.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR44714.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR49998.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR54883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR60076.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR65255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR70213.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR75535.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR80448.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR86189.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR92227.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR96261.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBR97135.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS06874.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS21316.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS26265.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS31184.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS37774.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS41012.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS44942.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS51463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS55604.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS60537.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS66512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS74100.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS75863.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS80035.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS84131.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS89048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS93910.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBS99536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT07805.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT07894.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT15576.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT22857.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT27144.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT27900.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT36543.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT38044.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT38739.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT47352.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT53194.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT54357.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT63500.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT69212.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT74344.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT79188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT83215.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT88383.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT88766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT97679.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBT98526.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU02774.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU08358.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU10879.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU20907.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU22100.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU26874.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU31721.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU36975.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU46030.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU47158.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU52065.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU56252.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU61444.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU69018.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU76101.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU78739.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU87012.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU88767.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PBU91868.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCD47561.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCD53348.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCD74301.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG21411.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG26740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG31892.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG39864.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG41870.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG47118.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCG52606.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATG07988.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATG12872.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATG60029.1| 50S ribosomal protein L10 [Escherichia coli O104:H21 str.
           CFSAN002236]
 gb|PCM04714.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM06192.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM09885.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM18597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM20930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM29918.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCM34622.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO21912.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO30519.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO54610.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO59020.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO75009.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO80218.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO85459.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCO96655.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCP02797.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCQ50536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCQ81523.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCQ86925.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCQ91902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCR52117.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCR57561.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCR62154.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCR67298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCR73125.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS33451.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS37443.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS40646.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS45414.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS49104.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS55703.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS59062.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS65830.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS72218.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS77123.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS79697.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS84493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS89523.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCS96265.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT01493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT10488.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT15434.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT20836.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT29309.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT31057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PCT35092.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATH70158.1| 50S ribosomal protein L10 [Shigella flexneri 1c]
 gb|ATH90274.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|ATI05025.1| 50S ribosomal protein L10 [Escherichia coli M12]
 gb|PDM28308.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDM42845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDM85041.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDM90207.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDM95314.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDN03927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDN89723.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDN91104.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDN94216.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO04965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO14299.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO22070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO22180.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO31430.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO34869.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO41495.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO42145.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO46571.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO55882.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO56559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO62623.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDO69271.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDS07651.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDS11965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDS16708.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDT93399.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDT98742.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU04017.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU09558.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU14709.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU19852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU25134.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU30691.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU36396.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU42366.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU48573.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU54599.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU60035.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU65256.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU70913.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU76188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU81645.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU87389.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU93447.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDU99155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV04313.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV09707.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV15215.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV22579.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV26214.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV31761.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV37322.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV42609.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV48115.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV55673.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV62742.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV68968.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV74667.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV80108.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PDV92175.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PEG21517.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PEH59257.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PEH94666.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PEH99881.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PEI19455.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PFF93737.1| 50S ribosomal protein L10 [Escherichia albertii]
 gb|PGF60463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF62138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF67279.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF72483.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF77998.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF79916.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF87927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF93293.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF93883.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGF94805.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG07376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG19158.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG22251.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG22533.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG36828.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG38559.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG41208.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG43348.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG54283.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG58654.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG64333.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG64942.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHG88637.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHG91845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHH28376.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATM10855.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATM26165.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATM82525.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHK60944.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHK70638.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL23322.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL30751.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL33409.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL38099.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL42983.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL48424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL53328.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL59582.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL63297.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL70903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL93148.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHL99867.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHN12064.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATO77276.1| 50S ribosomal protein L10 [Escherichia coli O91 str. RM7190]
 gb|PHU44144.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PHU48673.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PHU53178.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PHU57604.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PHU62615.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PHU67083.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PHU70396.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PHU75686.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PHU80100.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PHU83476.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PHU89736.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PHU92257.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PHU98109.1| 50S ribosomal protein L10 [Shigella boydii]
 emb|SLM09125.1| 50S ribosomal protein L10 [Escherichia coli O127:H6]
 emb|SNU19073.1| 50S ribosomal protein L10 [Escherichia coli O127:H6]
 gb|ATP23985.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHW96914.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PHW98581.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIA91035.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM06152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM11450.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM16100.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM20820.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM26080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM31008.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM35869.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM41612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM45717.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM57731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIM64051.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATU36859.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATV11359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATV48519.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATV77757.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PIS74099.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. USDA 5905]
 gb|ATW95431.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX09821.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX12882.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX18547.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX41383.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX48801.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX52417.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX57621.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF56440.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF62705.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF68684.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF70050.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF74357.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF83022.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF84047.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF87852.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJF94282.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG00686.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG02022.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG09982.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG13761.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG20710.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG21578.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG27970.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG34921.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJG74188.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATY20753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATY25235.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJH96807.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJI56754.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJI61420.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJN73647.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJO15509.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATX37607.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATZ40650.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJR33432.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. TW14313]
 gb|PJR39298.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. TB182A]
 gb|PJR44862.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. EC1825]
 gb|PJW24871.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW29046.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW33771.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW38739.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW48123.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW53082.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW58143.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW63019.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW68085.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW73038.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW77763.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW82599.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW88196.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJW96712.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJX01762.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATZ32403.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJX82203.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJX86765.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJX93634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJX94496.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY04063.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY09526.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY12262.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY21048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY21583.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY27670.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY36152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY37407.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY47135.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY52284.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY57953.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY59185.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PJY89616.1| 50S ribosomal protein L10 [Shigella sonnei]
 emb|SMZ47378.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|AUA41791.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUA44663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD52628.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD59205.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD59621.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD71930.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD73170.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD81993.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD86057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKD93276.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE02620.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE09812.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE78753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE82011.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE90148.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE96693.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKE97902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKF06284.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKF12629.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKF55764.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKG05106.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKI86445.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKI96021.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ02074.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ04969.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ10201.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ16762.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ21313.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ25277.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ32457.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ40578.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ40997.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKJ47304.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUF77731.1| 50S ribosomal protein L10 [Escherichia coli O121:H19]
 gb|AUG18666.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|PKQ94051.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKR61819.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKR69011.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKR71709.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUG67148.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUG95963.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|PKZ09845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKZ32204.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKZ47740.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PKZ75220.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLA84346.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLA98327.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLB60080.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLB61614.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLB66153.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLB70720.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLB75634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUJ93298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUJ94259.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUK03260.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUK08529.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUK13841.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUK18996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUK24118.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLJ79099.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLJ80839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLJ85161.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLJ96042.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLK03979.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLK07502.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PLK07970.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUF93479.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUL65688.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUL67629.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUL87395.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUL92821.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUM10199.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUM24776.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUN49612.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PMB59959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PMD76879.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PMD87593.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PMD88839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PME01469.1| 50S ribosomal protein L10 [Escherichia coli]
 emb|SOQ96825.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ91137.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOR03749.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ87381.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ61461.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ69026.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ79911.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ81951.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOQ72654.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 emb|SOR07555.1| 50S ribosomal subunit protein L10 [Escherichia coli]
 gb|AUO34863.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUO40718.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUO59569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNB89839.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNB94996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNC16504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND42766.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUQ39893.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND66805.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND72649.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND75910.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND84170.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PND96951.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNL71349.1| 50S ribosomal protein L10 [Escherichia coli O157]
 gb|PNM75132.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PNN27503.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNO48728.1| 50S ribosomal protein L10 [Shigella sonnei]
 gb|PNO95806.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNP03432.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PNP61845.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUP44280.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUS40312.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUS67901.1| 50S ribosomal protein L10 [Escherichia albertii]
 gb|PNR01378.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNR05931.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNR11294.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNR16854.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNR21290.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUT11217.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUN92866.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUT28828.1| 50S ribosomal protein L10 [Escherichia marmotae]
 gb|PNY42737.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNY58558.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNY58595.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PNY65152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUV21560.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUV31512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POF64819.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POF69504.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POF74671.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POF83700.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUU29671.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|POH44372.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POH76311.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POH90927.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POH93355.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POH95653.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POI04569.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POI13815.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL44690.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL49660.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL55716.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL56060.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL65616.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL73834.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL73961.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL81987.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL82600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL93442.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POL94493.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POM00931.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUX04846.1| LSU ribosomal protein L10p (P0) [Escherichia coli]
 gb|POO33368.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POO36691.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POO47941.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUY45130.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUY31187.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POR89908.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|POR96602.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|POS11634.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS13331.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS17976.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS26358.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS28962.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS39298.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS41967.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS42812.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS52102.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS53289.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS98186.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POS99902.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POT00562.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POT11061.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POT12117.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POT14190.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POU24676.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POV22195.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUZ91540.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|POZ07482.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVB47611.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPA51070.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVD31196.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE08714.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE13314.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE15679.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE23210.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE25601.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE33866.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE38452.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE43034.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE49349.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPE88779.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVE96274.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVG01641.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPO25787.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPO90777.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPQ50193.1| 50S ribosomal protein L10 [Escherichia albertii]
 gb|PPV43488.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV44770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV52949.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV56602.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV58600.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV67546.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV71057.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV82933.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV83487.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV92433.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV97562.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPV99353.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW07257.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW13040.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW13381.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW21780.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW24582.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW26997.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW38196.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW38672.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW40903.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW51579.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW54081.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW58465.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW68002.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW68519.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW77152.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW78568.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW81086.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW91928.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW93891.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPW94746.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX06727.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX11126.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX11462.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX21341.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX21960.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX30928.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX33770.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX39753.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX43150.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX48068.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX56315.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPX57370.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY58762.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY62966.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY65233.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY70944.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY78659.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY80424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY81647.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY93761.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY93870.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPY97705.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ06791.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ09780.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ17731.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ23965.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ25695.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ30799.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ39690.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ56170.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PPZ96367.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA01809.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA01838.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA03668.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA16050.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA16424.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA18933.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA29173.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA33642.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA38232.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA43663.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA50787.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA61959.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQA64008.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQH06896.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQI94000.1| 50S ribosomal protein L10 [Escherichia fergusonii]
 gb|PQI98480.1| 50S ribosomal protein L10 [Escherichia fergusonii]
 gb|PQK18567.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK24136.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK28365.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK30948.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK38682.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK43957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK44711.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK54433.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK60484.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQK61116.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVI54126.1| 50S ribosomal protein L10 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AVJ14980.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQM83476.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQM94671.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN02781.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN03288.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN04004.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|PQN13650.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN22190.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|PQN25759.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN26456.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN39110.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN39435.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PQN45553.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|PQN45680.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN48742.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|PQN62105.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN62517.1| 50S ribosomal protein L10 [Shigella boydii]
 gb|PQN67423.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN68566.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN73812.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN81896.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN87925.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN93901.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQN95475.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQO03446.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQO04307.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQO05941.1| 50S ribosomal protein L10 [Shigella dysenteriae]
 gb|PQO13896.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQO19484.1| 50S ribosomal protein L10 [Shigella flexneri]
 gb|PQO64145.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQO65837.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQO68487.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQO78413.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQO82418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQO84873.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQP06964.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQP31981.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVJ69138.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVJ76359.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQV17418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQV24319.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQV31625.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQV31640.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PQV33741.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRB31067.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRC14996.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVL32036.1| 50S ribosomal protein L10 [Escherichia coli O104:H4]
 gb|AVM04155.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP00536.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP00565.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP06214.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP11714.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP13609.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP21782.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP22945.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP27346.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP34330.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP37895.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRP47779.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVN03252.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVN10060.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVL08940.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVN37268.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRT59160.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRW36255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRW49258.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PRW54400.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSB93441.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF25834.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF26558.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF40156.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF43952.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF48027.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF55957.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF56913.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF62744.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF71255.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF72268.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF76023.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF85841.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF89684.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF91597.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSF99463.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG03825.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG08137.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG13320.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG19019.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG22512.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG27878.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG32048.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG37455.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG42172.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG46576.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG53583.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG56369.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG67890.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG74584.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSG80296.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AVP27967.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSK10622.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSK23328.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSL59247.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSL67532.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSL71509.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PSL74798.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  311 bits (798), Expect = e-103
 Identities = 165/165 (100%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_032262442.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KDW95865.1| 50S ribosomal protein L10 [Escherichia coli 2-210-07_S3_C2]
          Length = 165

 Score =  311 bits (797), Expect = e-103
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRA+EGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAIEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_103736552.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  311 bits (796), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLAT+PTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATMPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_003923800.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ENF46443.1| 50S ribosomal protein L10 [Escherichia coli P0304816.6]
          Length = 165

 Score =  311 bits (796), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNT+L
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTML 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_100039402.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAY+MEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYAMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_089645762.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQ+DRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQMDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_044808985.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS33411.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|KYS42298.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAK+AA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKDAA 165


>ref|WP_044067580.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ATB99948.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGR+AGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGRDAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_033547287.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARL+ATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLLATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_023156879.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ESA93322.1| ribosomal protein L10 [Escherichia coli 907779]
          Length = 165

 Score =  310 bits (795), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD+KEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDSKEAA 165


>ref|WP_098030698.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 164/165 (99%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKE A
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEVA 165


>ref|WP_098704418.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|PGG15594.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 164/165 (99%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIP 
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPV 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_104457517.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OZO52617.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|AUY03043.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPF+CLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFKCLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_096261586.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 165/165 (100%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDK+AIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKKAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_069372217.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|ODQ05164.1| 50S ribosomal protein L10 [Shigella sp. FC569]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 164/165 (99%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAK NAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKVNAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165


>ref|WP_064232206.1| 50S ribosomal protein L10 [Escherichia coli]
 gb|OAO66370.1| 50S ribosomal protein L10 [Escherichia coli]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 164/165 (99%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLM TMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMTTMKEASAGKLVRTLAAVRDAKEAA 165


>emb|CDW59664.1| Ribosomal L10 domain containing protein [Trichuris trichiura]
          Length = 165

 Score =  310 bits (794), Expect = e-102
 Identities = 164/165 (99%), Positives = 164/165 (99%)
 Frame = +2

Query: 311 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 490
           MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
Sbjct: 1   MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL 60

Query: 491 RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 670
           RRAVEGTPFECLKD FVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
Sbjct: 61  RRAVEGTPFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA 120

Query: 671 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 805
           SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Sbjct: 121 SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA 165