BLASTX nr result
ID: Acanthopanax23_contig00008945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00008945 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022854815.1| vacuolar protein sorting-associated protein ... 55 3e-06 >ref|XP_022854815.1| vacuolar protein sorting-associated protein 32 homolog 2-like [Olea europaea var. sylvestris] Length = 218 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = +2 Query: 2 NLKSWKVLSWRKNFFSLQPRPLWLQYMSRPAANQLVLFLRGAQLRKMNWLHYRLKW 169 NLKSWK LSWR NF +L PL LQ+ +N V L Q RKM+ LH R +W Sbjct: 158 NLKSWKELSWRNNFCNLPQPPLLLQFKCPLESNLYVQLLARIQKRKMSLLHCRQRW 213