BLASTX nr result
ID: Acanthopanax23_contig00008797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00008797 (688 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN03730.1| hypothetical protein DCAR_012486 [Daucus carota s... 72 1e-11 ref|XP_019250619.1| PREDICTED: COMPASS-like H3K4 histone methyla... 73 1e-11 ref|XP_016470610.1| PREDICTED: COMPASS-like H3K4 histone methyla... 72 4e-11 ref|XP_009796649.1| PREDICTED: WD repeat-containing protein 5 [N... 72 4e-11 ref|XP_009598919.1| PREDICTED: COMPASS-like H3K4 histone methyla... 72 4e-11 ref|XP_017242792.1| PREDICTED: COMPASS-like H3K4 histone methyla... 72 5e-11 ref|XP_019452681.1| PREDICTED: COMPASS-like H3K4 histone methyla... 72 5e-11 ref|XP_010277470.1| PREDICTED: COMPASS-like H3K4 histone methyla... 71 7e-11 ref|XP_004495198.1| PREDICTED: COMPASS-like H3K4 histone methyla... 71 1e-10 gb|OVA12595.1| WD40 repeat [Macleaya cordata] 70 1e-10 emb|CDP14622.1| unnamed protein product [Coffea canephora] 68 2e-10 gb|PON55256.1| Guanine nucleotide-binding protein, beta subunit ... 68 2e-10 ref|XP_020519765.1| COMPASS-like H3K4 histone methylase componen... 70 2e-10 ref|XP_016182941.1| COMPASS-like H3K4 histone methylase componen... 70 2e-10 ref|XP_015948400.1| COMPASS-like H3K4 histone methylase componen... 70 2e-10 gb|KHN18876.1| WD repeat-containing protein 5 [Glycine soja] 67 2e-10 gb|KHN03803.1| WD repeat-containing protein 5 [Glycine soja] 67 3e-10 ref|XP_011079866.1| COMPASS-like H3K4 histone methylase componen... 69 3e-10 ref|XP_006444050.1| COMPASS-like H3K4 histone methylase componen... 69 4e-10 gb|PIN18253.1| Conserved WD40 repeat-containing protein [Handroa... 69 4e-10 >gb|KZN03730.1| hypothetical protein DCAR_012486 [Daucus carota subsp. sativus] Length = 191 Score = 71.6 bits (174), Expect = 1e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTV+SV+CHPTENMIASAGLD DRT+RIWVQD Sbjct: 157 GHTDTVVSVSCHPTENMIASAGLDLDRTIRIWVQD 191 >ref|XP_019250619.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nicotiana attenuata] gb|OIT01290.1| compass-like h3k4 histone methylase component wdr5b [Nicotiana attenuata] Length = 312 Score = 73.2 bits (178), Expect = 1e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTENMI SAGLD DRTLR+WVQD Sbjct: 278 GHTDTVISVTCHPTENMIVSAGLDNDRTLRVWVQD 312 >ref|XP_016470610.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nicotiana tabacum] Length = 311 Score = 72.0 bits (175), Expect = 4e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTENMI SAGLD DRT+R+WVQD Sbjct: 277 GHTDTVISVTCHPTENMIVSAGLDNDRTVRVWVQD 311 >ref|XP_009796649.1| PREDICTED: WD repeat-containing protein 5 [Nicotiana sylvestris] ref|XP_016499290.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nicotiana tabacum] Length = 311 Score = 72.0 bits (175), Expect = 4e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTENMI SAGLD DRT+R+WVQD Sbjct: 277 GHTDTVISVTCHPTENMIVSAGLDNDRTVRVWVQD 311 >ref|XP_009598919.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nicotiana tomentosiformis] ref|XP_018625705.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nicotiana tomentosiformis] Length = 312 Score = 72.0 bits (175), Expect = 4e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTENMI SAGLD DRT+R+WVQD Sbjct: 278 GHTDTVISVTCHPTENMIVSAGLDNDRTVRVWVQD 312 >ref|XP_017242792.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Daucus carota subsp. sativus] Length = 307 Score = 71.6 bits (174), Expect = 5e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTV+SV+CHPTENMIASAGLD DRT+RIWVQD Sbjct: 273 GHTDTVVSVSCHPTENMIASAGLDLDRTIRIWVQD 307 >ref|XP_019452681.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] ref|XP_019452682.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] gb|OIW06741.1| hypothetical protein TanjilG_11466 [Lupinus angustifolius] Length = 320 Score = 71.6 bits (174), Expect = 5e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGLD DRT+RIWVQD Sbjct: 285 GHTDTVISVTCHPTENKIASAGLDNDRTVRIWVQD 319 >ref|XP_010277470.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nelumbo nucifera] Length = 317 Score = 71.2 bits (173), Expect = 7e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGLD+DRT++IWVQD Sbjct: 282 GHTDTVISVTCHPTENKIASAGLDKDRTIKIWVQD 316 >ref|XP_004495198.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Cicer arietinum] Length = 326 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGLD DRT+RIWVQD Sbjct: 291 GHTDTVISVTCHPTENKIASAGLDGDRTVRIWVQD 325 >gb|OVA12595.1| WD40 repeat [Macleaya cordata] Length = 326 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGL++DRT+RIWVQD Sbjct: 291 GHTDTVISVTCHPTENKIASAGLERDRTVRIWVQD 325 >emb|CDP14622.1| unnamed protein product [Coffea canephora] Length = 162 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTD VISVTCHP ENMI SAGLD DR+LRIWVQD Sbjct: 128 GHTDVVISVTCHPIENMIVSAGLDNDRSLRIWVQD 162 >gb|PON55256.1| Guanine nucleotide-binding protein, beta subunit [Parasponia andersonii] Length = 163 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GH+DTVISV+CHPTEN IASAGLD DRT+RIWVQD Sbjct: 128 GHSDTVISVSCHPTENKIASAGLDGDRTVRIWVQD 162 >ref|XP_020519765.1| COMPASS-like H3K4 histone methylase component WDR5B [Amborella trichopoda] gb|ERN00806.1| hypothetical protein AMTR_s00103p00026300 [Amborella trichopoda] Length = 316 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQ 586 GHTDTVISV+CHPTENMIASAGLD DRT+RIWVQ Sbjct: 280 GHTDTVISVSCHPTENMIASAGLDNDRTVRIWVQ 313 >ref|XP_016182941.1| COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] ref|XP_016182942.1| COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] Length = 319 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISV+CHPTEN IASAGLD DRT+RIWVQD Sbjct: 284 GHTDTVISVSCHPTENKIASAGLDNDRTVRIWVQD 318 >ref|XP_015948400.1| COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] ref|XP_015948401.1| COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] ref|XP_015948402.1| COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] Length = 319 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISV+CHPTEN IASAGLD DRT+RIWVQD Sbjct: 284 GHTDTVISVSCHPTENKIASAGLDNDRTVRIWVQD 318 >gb|KHN18876.1| WD repeat-containing protein 5 [Glycine soja] Length = 163 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGL DRT+R+WVQD Sbjct: 128 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQD 162 >gb|KHN03803.1| WD repeat-containing protein 5 [Glycine soja] Length = 172 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISVTCHPTEN IASAGL DRT+R+WVQD Sbjct: 137 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQD 171 >ref|XP_011079866.1| COMPASS-like H3K4 histone methylase component WDR5B [Sesamum indicum] ref|XP_020550441.1| COMPASS-like H3K4 histone methylase component WDR5B [Sesamum indicum] Length = 316 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTV+SVTCHP ENMI SAGLD DRT+R+WVQD Sbjct: 282 GHTDTVVSVTCHPKENMIVSAGLDNDRTVRVWVQD 316 >ref|XP_006444050.1| COMPASS-like H3K4 histone methylase component WDR5B [Citrus clementina] ref|XP_006479705.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Citrus sinensis] gb|ESR57290.1| hypothetical protein CICLE_v10021263mg [Citrus clementina] gb|KDO68705.1| hypothetical protein CISIN_1g021459mg [Citrus sinensis] dbj|GAY40674.1| hypothetical protein CUMW_053800 [Citrus unshiu] Length = 312 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTD+VISVTCHPTEN IASAGLD DRT+R+WVQD Sbjct: 277 GHTDSVISVTCHPTENKIASAGLDGDRTVRVWVQD 311 >gb|PIN18253.1| Conserved WD40 repeat-containing protein [Handroanthus impetiginosus] Length = 315 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 687 GHTDTVISVTCHPTENMIASAGLDQDRTLRIWVQD 583 GHTDTVISV+CHPT NMI SAGLD DRTLR+WVQD Sbjct: 281 GHTDTVISVSCHPTVNMIVSAGLDNDRTLRVWVQD 315