BLASTX nr result
ID: Acanthopanax23_contig00007889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00007889 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236152.1| PREDICTED: ion channel DMI1-like [Daucus car... 55 3e-08 emb|CDO97603.1| unnamed protein product [Coffea canephora] 46 9e-06 >ref|XP_017236152.1| PREDICTED: ion channel DMI1-like [Daucus carota subsp. sativus] gb|KZN05838.1| hypothetical protein DCAR_006675 [Daucus carota subsp. sativus] Length = 911 Score = 55.1 bits (131), Expect(2) = 3e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 224 IFFSDQRFSVSNRNYIYPSFLGPYCFRTRVTVK 322 I SDQRF VS+R+Y+YPSFLGPY RTRVTVK Sbjct: 47 ISLSDQRFGVSDRDYVYPSFLGPYSSRTRVTVK 79 Score = 30.4 bits (67), Expect(2) = 3e-08 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 111 DSQPPHFSGPLFSVVHRFTSRP 176 D PPHF GPLF V R + P Sbjct: 22 DPPPPHFPGPLFPAVRRTAASP 43 >emb|CDO97603.1| unnamed protein product [Coffea canephora] Length = 956 Score = 46.2 bits (108), Expect(2) = 9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = +2 Query: 233 SDQRFSVSNRNYIYPSFLGPYCFRTRVTVKPLLQINN 343 SDQ F+ S+R+Y+YPSFLGPY R+RV K +N Sbjct: 85 SDQAFNFSDRDYVYPSFLGPYATRSRVAAKSAAHNSN 121 Score = 30.8 bits (68), Expect(2) = 9e-06 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 105 AEDSQPPHFSGPLFSVVHRFTSRP 176 +++++ PHF GPLF V R T+ P Sbjct: 40 SDETRTPHFPGPLFPAVRRVTTSP 63