BLASTX nr result
ID: Acanthopanax23_contig00007765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00007765 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554396.1| PREDICTED: ACT domain-containing protein ACR... 62 2e-08 ref|XP_019444308.1| PREDICTED: ACT domain-containing protein ACR... 60 7e-08 ref|XP_020212291.1| ACT domain-containing protein ACR10-like [Ca... 60 7e-08 gb|KDO44436.1| hypothetical protein CISIN_1g015208mg [Citrus sin... 60 9e-08 emb|CDP15279.1| unnamed protein product [Coffea canephora] 60 1e-07 ref|XP_014629370.1| PREDICTED: ACT domain-containing protein ACR... 60 1e-07 ref|XP_024038488.1| ACT domain-containing protein ACR10 isoform ... 60 1e-07 gb|KDO44435.1| hypothetical protein CISIN_1g015208mg [Citrus sin... 60 1e-07 ref|XP_006491661.1| PREDICTED: ACT domain-containing protein ACR... 60 1e-07 dbj|GAU20331.1| hypothetical protein TSUD_338120 [Trifolium subt... 60 1e-07 dbj|GAY63130.1| hypothetical protein CUMW_223140 [Citrus unshiu] 60 1e-07 ref|XP_006428457.1| ACT domain-containing protein ACR10 isoform ... 60 1e-07 ref|XP_021817159.1| ACT domain-containing protein ACR10 [Prunus ... 60 1e-07 ref|XP_007202236.2| ACT domain-containing protein ACR10 [Prunus ... 60 1e-07 ref|XP_008241389.1| PREDICTED: ACT domain-containing protein ACR... 60 1e-07 ref|XP_017413318.1| PREDICTED: ACT domain-containing protein ACR... 59 2e-07 gb|PNY01447.1| amino acid binding protein [Trifolium pratense] 59 2e-07 ref|XP_024188742.1| ACT domain-containing protein ACR10 [Rosa ch... 59 3e-07 dbj|GAU43513.1| hypothetical protein TSUD_399070 [Trifolium subt... 59 3e-07 ref|XP_004304473.1| PREDICTED: ACT domain-containing protein ACR... 59 3e-07 >ref|XP_003554396.1| PREDICTED: ACT domain-containing protein ACR10-like [Glycine max] gb|KHN02308.1| hypothetical protein glysoja_002332 [Glycine soja] gb|KRG96034.1| hypothetical protein GLYMA_19G185300 [Glycine max] Length = 412 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYR+LLDEGDGLSV +N IEK VWKMLMGWE Sbjct: 381 EVYRILLDEGDGLSVPRNKIEKGVWKMLMGWE 412 >ref|XP_019444308.1| PREDICTED: ACT domain-containing protein ACR10-like [Lupinus angustifolius] gb|OIW11306.1| hypothetical protein TanjilG_20455 [Lupinus angustifolius] Length = 412 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYR+LLDEG+GLSV +N IEK VWKMLMGWE Sbjct: 381 EVYRILLDEGEGLSVPRNKIEKGVWKMLMGWE 412 >ref|XP_020212291.1| ACT domain-containing protein ACR10-like [Cajanus cajan] gb|KYP70912.1| [Protein-PII] uridylyltransferase [Cajanus cajan] Length = 412 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYR+LLDEG+GLSV +N IEK VWKMLMGWE Sbjct: 381 EVYRILLDEGEGLSVPRNKIEKGVWKMLMGWE 412 >gb|KDO44436.1| hypothetical protein CISIN_1g015208mg [Citrus sinensis] Length = 261 Score = 59.7 bits (143), Expect = 9e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 230 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 261 >emb|CDP15279.1| unnamed protein product [Coffea canephora] Length = 411 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV + IE+AVWKMLMGWE Sbjct: 380 EVYRVLLDEGDGLSVPREKIEQAVWKMLMGWE 411 >ref|XP_014629370.1| PREDICTED: ACT domain-containing protein ACR10-like [Glycine max] gb|KHN18678.1| hypothetical protein glysoja_021429 [Glycine soja] gb|KRH67754.1| hypothetical protein GLYMA_03G184800 [Glycine max] Length = 412 Score = 60.1 bits (144), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYR+LLDEG+GLS+ +N IEK VWKMLMGWE Sbjct: 381 EVYRILLDEGEGLSIPRNKIEKGVWKMLMGWE 412 >ref|XP_024038488.1| ACT domain-containing protein ACR10 isoform X3 [Citrus clementina] Length = 331 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 300 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 331 >gb|KDO44435.1| hypothetical protein CISIN_1g015208mg [Citrus sinensis] Length = 343 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 312 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 343 >ref|XP_006491661.1| PREDICTED: ACT domain-containing protein ACR10 isoform X2 [Citrus sinensis] ref|XP_024038487.1| ACT domain-containing protein ACR10 isoform X2 [Citrus clementina] gb|KDO44434.1| hypothetical protein CISIN_1g015208mg [Citrus sinensis] Length = 372 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 341 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 372 >dbj|GAU20331.1| hypothetical protein TSUD_338120 [Trifolium subterraneum] Length = 405 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEG+GLS+ +N IEK VWKMLMGWE Sbjct: 374 EVYRVLLDEGEGLSLPRNKIEKGVWKMLMGWE 405 >dbj|GAY63130.1| hypothetical protein CUMW_223140 [Citrus unshiu] Length = 411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 380 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 411 >ref|XP_006428457.1| ACT domain-containing protein ACR10 isoform X1 [Citrus clementina] ref|XP_006491660.1| PREDICTED: ACT domain-containing protein ACR10 isoform X1 [Citrus sinensis] gb|ESR41697.1| hypothetical protein CICLE_v10011863mg [Citrus clementina] gb|KDO44433.1| hypothetical protein CISIN_1g015208mg [Citrus sinensis] Length = 411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGLSV +N IE+ VWK+LMGWE Sbjct: 380 EVYRVLLDEGDGLSVPRNKIEEGVWKLLMGWE 411 >ref|XP_021817159.1| ACT domain-containing protein ACR10 [Prunus avium] Length = 412 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVL+DEGDGLSV +N IE+ VWKMLMGWE Sbjct: 381 EVYRVLIDEGDGLSVPRNKIEEQVWKMLMGWE 412 >ref|XP_007202236.2| ACT domain-containing protein ACR10 [Prunus persica] gb|ONH96407.1| hypothetical protein PRUPE_7G127300 [Prunus persica] Length = 412 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVL+DEGDGLSV +N IE+ VWKMLMGWE Sbjct: 381 EVYRVLIDEGDGLSVPRNKIEEQVWKMLMGWE 412 >ref|XP_008241389.1| PREDICTED: ACT domain-containing protein ACR10 [Prunus mume] Length = 412 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVL+DEGDGLSV +N IE+ VWKMLMGWE Sbjct: 381 EVYRVLIDEGDGLSVPRNKIEEQVWKMLMGWE 412 >ref|XP_017413318.1| PREDICTED: ACT domain-containing protein ACR10-like [Vigna angularis] gb|KOM34823.1| hypothetical protein LR48_Vigan02g097300 [Vigna angularis] dbj|BAT95793.1| hypothetical protein VIGAN_08259800 [Vigna angularis var. angularis] Length = 412 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEG+GLS+ KN IE+ VWKMLMGWE Sbjct: 381 EVYRVLLDEGEGLSLPKNKIEEGVWKMLMGWE 412 >gb|PNY01447.1| amino acid binding protein [Trifolium pratense] Length = 316 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEG+GLS +N IEK VWKMLMGWE Sbjct: 285 EVYRVLLDEGEGLSFPRNKIEKGVWKMLMGWE 316 >ref|XP_024188742.1| ACT domain-containing protein ACR10 [Rosa chinensis] gb|PRQ43632.1| putative [Protein-PII] uridylyltransferase [Rosa chinensis] Length = 412 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGL V +N IE+ VWKMLMGWE Sbjct: 381 EVYRVLLDEGDGLPVPRNKIEEGVWKMLMGWE 412 >dbj|GAU43513.1| hypothetical protein TSUD_399070 [Trifolium subterraneum] Length = 412 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYR+LLDEG+GLSV +N IE+ VWKMLMGWE Sbjct: 381 EVYRILLDEGEGLSVPRNKIEEGVWKMLMGWE 412 >ref|XP_004304473.1| PREDICTED: ACT domain-containing protein ACR10 [Fragaria vesca subsp. vesca] Length = 412 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 EVYRVLLDEGDGLSVSKNMIEKAVWKMLMGWE 97 EVYRVLLDEGDGL V +N IE+ VWKMLMGWE Sbjct: 381 EVYRVLLDEGDGLPVPRNKIEEGVWKMLMGWE 412