BLASTX nr result
ID: Acanthopanax23_contig00005586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00005586 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019103620.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 64 4e-09 ref|XP_010670760.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 64 4e-09 ref|XP_021746266.1| E3 ubiquitin-protein ligase At1g63170-like [... 64 5e-09 ref|XP_021758096.1| E3 ubiquitin-protein ligase At1g12760-like [... 64 5e-09 gb|KNA22784.1| hypothetical protein SOVF_031240 [Spinacia oleracea] 63 1e-08 ref|XP_021836986.1| E3 ubiquitin-protein ligase At1g12760 [Spina... 63 1e-08 ref|XP_017231465.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 62 2e-08 gb|KVH89940.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 60 8e-08 ref|XP_023764526.1| E3 ubiquitin-protein ligase At1g63170 [Lactu... 60 1e-07 ref|XP_022866062.1| E3 ubiquitin-protein ligase At4g11680-like [... 58 2e-07 ref|XP_022862981.1| E3 ubiquitin-protein ligase At1g63170-like [... 59 2e-07 ref|XP_006476189.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 59 2e-07 ref|XP_006450563.1| E3 ubiquitin-protein ligase At1g63170 [Citru... 59 2e-07 ref|XP_006596122.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 59 3e-07 gb|KHN12061.1| E3 ubiquitin-protein ligase [Glycine soja] 59 3e-07 ref|XP_006601116.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 59 3e-07 ref|XP_011081882.1| E3 ubiquitin-protein ligase At1g63170 [Sesam... 59 3e-07 ref|XP_003545507.2| PREDICTED: E3 ubiquitin-protein ligase At1g6... 59 3e-07 gb|KHN25509.1| E3 ubiquitin-protein ligase [Glycine soja] 59 3e-07 ref|XP_021276745.1| E3 ubiquitin-protein ligase At1g12760 isofor... 59 3e-07 >ref|XP_019103620.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 408 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVG+T+LSS++G TA ++ A Sbjct: 365 CVDKWLKINALCPLCKNEVGDTLLSSLAGATASLRRA 401 >ref|XP_010670760.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT16888.1| hypothetical protein BVRB_2g043630 [Beta vulgaris subsp. vulgaris] Length = 428 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVG+T+LSS++G TA ++ A Sbjct: 385 CVDKWLKINALCPLCKNEVGDTLLSSLAGATASLRRA 421 >ref|XP_021746266.1| E3 ubiquitin-protein ligase At1g63170-like [Chenopodium quinoa] Length = 427 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVGE++LSS++G TA ++ A Sbjct: 384 CVDKWLKINALCPLCKNEVGESLLSSLAGATASLRRA 420 >ref|XP_021758096.1| E3 ubiquitin-protein ligase At1g12760-like [Chenopodium quinoa] ref|XP_021758097.1| E3 ubiquitin-protein ligase At1g12760-like [Chenopodium quinoa] Length = 427 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVGE++LSS++G TA ++ A Sbjct: 384 CVDKWLKINALCPLCKNEVGESLLSSLAGATASLRRA 420 >gb|KNA22784.1| hypothetical protein SOVF_031240 [Spinacia oleracea] Length = 407 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVG+++LSS++G TA ++ A Sbjct: 364 CVDKWLKINALCPLCKNEVGDSLLSSLAGATASLRRA 400 >ref|XP_021836986.1| E3 ubiquitin-protein ligase At1g12760 [Spinacia oleracea] ref|XP_021836987.1| E3 ubiquitin-protein ligase At1g12760 [Spinacia oleracea] Length = 427 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMA 332 CVDKWLKINALCPLCK EVG+++LSS++G TA ++ A Sbjct: 384 CVDKWLKINALCPLCKNEVGDSLLSSLAGATASLRRA 420 >ref|XP_017231465.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Daucus carota subsp. sativus] gb|KZN08844.1| hypothetical protein DCAR_001500 [Daucus carota subsp. sativus] Length = 414 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMAA 329 CVDKWLKINALCPLCKGEVG+ ILS++S E QM A Sbjct: 375 CVDKWLKINALCPLCKGEVGDKILSTLSRENTNSQMNA 412 >gb|KVH89940.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 364 Score = 60.5 bits (145), Expect = 8e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQMAA 329 CVDKWLKINA CPLCK EVGETILSS++ TA ++ +A Sbjct: 325 CVDKWLKINASCPLCKTEVGETILSSLTEATASLRRSA 362 >ref|XP_023764526.1| E3 ubiquitin-protein ligase At1g63170 [Lactuca sativa] ref|XP_023764527.1| E3 ubiquitin-protein ligase At1g63170 [Lactuca sativa] ref|XP_023764528.1| E3 ubiquitin-protein ligase At1g63170 [Lactuca sativa] gb|PLY84900.1| hypothetical protein LSAT_6X10820 [Lactuca sativa] Length = 427 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINA CPLCK EVGETILSS++ TA ++ Sbjct: 388 CVDKWLKINATCPLCKSEVGETILSSLTEATASLR 422 >ref|XP_022866062.1| E3 ubiquitin-protein ligase At4g11680-like [Olea europaea var. sylvestris] Length = 196 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINA CPLCK EVGET LSS++ TA ++ Sbjct: 157 CVDKWLKINASCPLCKAEVGETFLSSLTEATASLR 191 >ref|XP_022862981.1| E3 ubiquitin-protein ligase At1g63170-like [Olea europaea var. sylvestris] ref|XP_022862982.1| E3 ubiquitin-protein ligase At1g63170-like [Olea europaea var. sylvestris] Length = 423 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINA CPLCK EVGET+LSS++ TA ++ Sbjct: 384 CVDKWLKINASCPLCKAEVGETVLSSLTEATASLR 418 >ref|XP_006476189.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Citrus sinensis] gb|KDO79625.1| hypothetical protein CISIN_1g013255mg [Citrus sinensis] gb|KDO79626.1| hypothetical protein CISIN_1g013255mg [Citrus sinensis] dbj|GAY60185.1| hypothetical protein CUMW_200030 [Citrus unshiu] dbj|GAY60186.1| hypothetical protein CUMW_200030 [Citrus unshiu] Length = 447 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGI 341 CVDKWLKINA CPLCK EVG+T+L SISG A I Sbjct: 387 CVDKWLKINASCPLCKSEVGDTVLGSISGANARI 420 >ref|XP_006450563.1| E3 ubiquitin-protein ligase At1g63170 [Citrus clementina] gb|ESR63803.1| hypothetical protein CICLE_v10008289mg [Citrus clementina] gb|ESR63805.1| hypothetical protein CICLE_v10008289mg [Citrus clementina] Length = 447 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGI 341 CVDKWLKINA CPLCK EVG+T+L SISG A I Sbjct: 387 CVDKWLKINASCPLCKSEVGDTVLGSISGANARI 420 >ref|XP_006596122.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] gb|KRH16047.1| hypothetical protein GLYMA_14G129100 [Glycine max] gb|KRH16048.1| hypothetical protein GLYMA_14G129100 [Glycine max] Length = 418 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINALCPLCK +VGE + S+SGE A Q Sbjct: 369 CVDKWLKINALCPLCKSDVGENLTGSVSGEDASQQ 403 >gb|KHN12061.1| E3 ubiquitin-protein ligase [Glycine soja] Length = 419 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINALCPLCK +VGE + S+SGE A Q Sbjct: 370 CVDKWLKINALCPLCKSDVGENLTGSVSGEDASQQ 404 >ref|XP_006601116.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] ref|XP_006601117.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] ref|XP_006601118.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] ref|XP_014625486.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] ref|XP_014625487.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] gb|KRH05038.1| hypothetical protein GLYMA_17G203800 [Glycine max] gb|KRH05039.1| hypothetical protein GLYMA_17G203800 [Glycine max] gb|KRH05040.1| hypothetical protein GLYMA_17G203800 [Glycine max] gb|KRH05041.1| hypothetical protein GLYMA_17G203800 [Glycine max] Length = 419 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINALCPLCK +VGE + S+SGE A Q Sbjct: 370 CVDKWLKINALCPLCKSDVGENLTGSVSGEDASQQ 404 >ref|XP_011081882.1| E3 ubiquitin-protein ligase At1g63170 [Sesamum indicum] ref|XP_011081883.1| E3 ubiquitin-protein ligase At1g63170 [Sesamum indicum] ref|XP_011081885.1| E3 ubiquitin-protein ligase At1g63170 [Sesamum indicum] Length = 426 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINA CPLCK EVGET+LSS++ TA ++ Sbjct: 387 CVDKWLKINATCPLCKAEVGETMLSSLTEATASLR 421 >ref|XP_003545507.2| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X1 [Glycine max] Length = 436 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINALCPLCK +VGE + S+SGE A Q Sbjct: 387 CVDKWLKINALCPLCKSDVGENLTGSVSGEDASQQ 421 >gb|KHN25509.1| E3 ubiquitin-protein ligase [Glycine soja] Length = 440 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGIQ 338 CVDKWLKINALCPLCK +VGE + S+SGE A Q Sbjct: 391 CVDKWLKINALCPLCKSDVGENLTGSVSGEDASQQ 425 >ref|XP_021276745.1| E3 ubiquitin-protein ligase At1g12760 isoform X2 [Herrania umbratica] Length = 446 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 442 CVDKWLKINALCPLCKGEVGETILSSISGETAGI 341 CVDKWLKINA CPLCK EVGE IL +ISG +A I Sbjct: 374 CVDKWLKINASCPLCKSEVGENILDAISGTSASI 407